[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36480.1


[Show Plain Result]

## Summary of Sequence Search
   1::716
   8::698  PF09960 0.0% 43.5272045028143  Uncharacterized protein conserved in bacteria (DUF2 
   1::716


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKFLLLILVLLAFPFFSKTLLLYKGSEGGYGYNILSWLAPEPEVLGEDYEFVDVEKSLPDFEDYDFVIT
PF09960         -------illilflqils..lLlYk.............................................


                         -         -         *         -         -         -         -:140
query           CYYSSSMPGAKKYLKKLVDFLLNGGKLFIINNLGAFEDSSGDNPSLSDINTLLNLLGVSFRYGWRQETVF
PF09960         ................................................inlllnklgvsytvgnkkekvf


                         +         -         -         -         -         *         -:210
query           SYEIEDGYLIKLPSFPVKKAFDGFEVFSSNVKIVSYAVTKKGKHPVIFYGPFGGMALFDHAFNENGEPVV
PF09960         ek........tlksakvaknldkyklv................................slfdennevsl


                         -         -         -         +         -         -         -:280
query           DLRKIVMDIVGGYRENKVLMLDENHHIRKMFEYALFEVDSSRSGVLQKYRAIVIPDVSFLEEKEIKSYLE
PF09960         ei.....................kkqiekileyaklevktvdianevkeeipslldyraviilledlksl


                         -         *         -         -         -         -         +:350
query           NGGVVILVGSGTHYIQGEVVLEKENLYIPQDITVGERKVGYIPAPENAKAFITISGTPVSWMEKREKGAF
PF09960         edeeiknyvenGGnvllieklekkskldkilGiksskekkevkklkidkdlliggkdlyeleeefesslk


                         -         -         -         -         *         -         -:420
query           VFFPEDLLEKWSRGILFNEFLEASDFVISPMVNAFSVFLDDFPLPAYGIEYDILGTTDEIFYYKIWWRDM
PF09960         vildeeskveaitssdktpviWekkegkGkvvvinedllekklrGlllqsiselldatiypvinaeivYl


                         -         -         +         -         -         -         -:490
query           KELCEDFSIKPITALVTSYEQKTDYNGFFEFLEKDSSLKVLKNLIEDERVDTGIHGYNHVPPKSENWDLE
PF09960         DDFPlPvysgeaksikreygisdeeFYykvWWkdlkklaeeynikytgvvienYeaktkppfsfveqknt


                         *         -         -         -         -         +         -:560
query           ELGKAYKSLRIFLSQLSSSYEPVAFVAPNNEIDQAGIEVLKSVFPTIKVIGTAYSLKDSTGEFTLLDDAL
PF09960         defilflkeLl.kskgeigiHGYNHlpllkendyvdeaeyktWkdkeelekalkelkkflkslfekaelk


                         -         -         -         *         -         -         -:630
query           ILPRTTSGCYPLQRLLMETVSTLLNLGTYHHFSHPDDVISLDRNPERYSWNEMFDQLRSFFRIMKENYPW
PF09960         vYvaPsNiidkeGveallkalPeiktigstYtssdskseyvqeFevledgiielPRitsGyypldelllt


                         -         +         -         -         -         -         *:700
query           LRNMDSKELYNTFKDYFENKPRILYHDKKIVIVLPRTAELPRYFFLKAKGDVNVHGGVILFRDKDLCVVE
PF09960         tvselnnlgvfqhFlHPDDvldedRn.anksWeellkalrkflkkikkkyPylrnqtssEaaeavkey--


                         -         -         -         -         +         -         -:770
query           MREYKMEISEVIEDGR------------------------------------------------------
PF09960         ----------------------------------------------------------------------