[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36720.1


[Show Plain Result]

## Summary of Sequence Search
   1::434
  77::288  PF00591 0.0% 22.5961538461538  Glycosyl transferase family, a/b domain 
 345::419  PF07831 0.0% 52  Pyrimidine nucleoside phosphorylase C-terminal doma 
   5::66   PF02885 0.0% 33.8709677419355  Glycosyl transferase family, helical bundle domain 
   1::434


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDEEETYYFTETMMRSGEVLD
PF00591         ----------------------------------------------------------------------
PF07831         ----------------------------------------------------------------------
PF02885         ----elikkllagedLsseeaeeamdailsgeasdaqiaafLtAlrvkgetaeEiagaakAmreha----


                         -         -         *         -         -         -         -:140
query           LSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
PF00591         ------dlvDivGTGGdgantfnvstaaaivvAaaGvkvakhgnrsvssksGsaDvLealg.vnleltpe
PF07831         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
PF00591         evrklleevgvaflfap.kyhpamkhvaavRkelgirtvfnllGp..LtnparaklqllGvyskelveal
PF07831         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALML
PF00591         aevleklgeeralvVhgedglDevtlagkttvaelkdgeiteytlepedfglkrgeleklkgglpeenae
PF07831         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ELAGVADFEEGKKILQEKLETGEALDKFRLLVKAQGGNERVVDDPWRVLPVAEQVVEFSAAREGFVSKID
PF00591         lleevLeg--------------------------------------------------------------
PF07831         ----------------------------------------------------------------yvseid
PF02885         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AEKVGIASMMLGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISD
PF00591         ----------------------------------------------------------------------
PF07831         areiglaaveLGAGRakkeDpidksvGielhkkvGdkVkkGeplatiyankeekleeavaklkkaikis-
PF02885         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SPSEPPRVVEEVIK--------------------------------------------------------
PF00591         ----------------------------------------------------------------------
PF07831         ----------------------------------------------------------------------
PF02885         ----------------------------------------------------------------------