[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36800.1


[Show Plain Result]

## Summary of Sequence Search
   1::1074
  19::363  PF03739 0.0% 30.1449275362319  Predicted permease YjgP/YjgQ family 
   1::1074


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNSFSSKNPEGCSLKVLIKYLLKLSVVPFLIGLGGFIVFVSLEILYQLSDLIVRHRVGIEKLFLMLYYYL
PF03739         ------------------rYilreflktfllvllvlvlllllgdliryldkfagkgldigdllelilyql


                         -         -         *         -         -         -         -:140
query           PYFVAMGVPVGVLLAIFWTFSRLSEERELMAIQVHGISQKNLIVPFLILGALLSIAVFFLSDQIVPEYQS
PF03739         pqllplvlPlalllatlltfgrLsrdsEltalrasGislgrllrpilvlalllsvltlllseyvvPrank


                         +         -         -         -         -         *         -:210
query           KAEEAMSKYVLKKPEVFVVENVISKIGDDQYFYVEKYDERTSTMWNVVIFRYGHEETIVTAKRVQKKGND
PF03739         klesllqeilnkkpsllirpgvfindgdgyviyvgkvddngnelkdviiydttadkgvtsiitAksavle


                         -         -         -         +         -         -         -:280
query           WYLFDGNYYTVDKDGFLKLDVHFSEMKLDITEDIEKLLRVGKTPKEMTGKELKEKIEFFKKVGVKPSPWV
PF03739         knnekklqltLkngeiyevnkdkaeysqisfdryeikinllpadlktskenpeelslseLksaikalksa


                         -         *         -         -         -         -         +:350
query           VELHSRYANSLTPIVIVLVGVPLSLLFQLRSKSWGVIFTFVLVVLYQGSGAWLSAMGKENLLNPVLAPWI
PF03739         glkvrkyeaelhkrlalplaclllvligiplglkkprggrglrlvlailiffiyyvlsslgealakggll


                         -         -         -         -         *         -         -:420
query           PNIVFTIVGTLLFILLDTFFAYRITEFLSRLFFVAFIFTVSSLFSSQVVIVSDRMEKFPEEMVFHGSVEI
PF03739         ppvlaawlpnilf---------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           AYKDMTVQASEATIQLTEEGKAKKLEASGGVIYRKADTILMGEHLIFYLENEKSVLTHIRGSTVLEIEKE
PF03739         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KKKIYLSGEDLTSEGSRTIVDMGSISTCSETPPHYKLKARYIEIKENDYLLAKDVVFYLLEIPLFYQPIF
PF03739         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           FTSLSDKPQPFSVEVGVGNNPHLKTSYNVSYPSGLLYFSTKSVLSGGLSKELNWNHKMGSWSLNLDYKES
PF03739         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TSHSVLVKIFDSKNTFLFSQKNEERIHQFERKEKILNGSLNVVLRKESDGEDSYILPRVTVKKVSVKTGV
PF03739         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           GTFSVDSFNHETRIEDQEKRNSGSVSLSFRSVPFLLFQSVSVSTTGKYLFENQNLDERTSYLKTDSIWDF
PF03739         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           QNLSLGKFLVLDDKIYAGVYRSNEDGYRVGNLFTTTLRVPLGPFSFESYYKLFTVSGENLRKFSQNESKN
PF03739         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           EVDLKVSFSYENFKSSLETTYDFLEKEFSDPYLKTSYSFKTGDITHTVDSTTRFVLDEISRSYTTWNFQQ
PF03739         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           RMGAFLNRFYFTYYYREPHVKYVEDQMRIYGKNFLFMENPRITTYTKLSVDPFELDEFWIRGTFKKGEST
PF03739         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           HSLKMSYSSDNLEFSYQTKNGDPALEISFSLKDWNVEKFSLSVEKALHCLGTKISTSFGRNFTLESFSIL
PF03739         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           FFIRDFPNSGIGFDTEEGIGLNVF----------------------------------------------
PF03739         ----------------------------------------------------------------------