[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36835.1


[Show Plain Result]

## Summary of Sequence Search
   1::497
   3::164  PF02734 0.0% 37.888198757764  DAK2 domain 
   1::497


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMADASPREY
PF02734         --pvGDGDtGtnmargaeavlkaleeleeeadlaevlkaiakallskagGtsGvlysqflraaakalkek


                         -         -         *         -         -         -         -:140
query           ITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHML
PF02734         eeldaeelakaleaal.eaikavGkakpgdkTmlDvlrpavealeaakdedleealeaaakaaekgaeaT


                         +         -         -         -         -         *         -:210
query           QKLREAGVVDAGAKGLYYIFEGMRDAVKGNIQVNLEEVEQASVEELQRMAFEEITNRYCTEVAVRRNQVV
PF02734         kellaklgrAsylgerslgvvDpG----------------------------------------------


                         -         -         -         +         -         -         -:280
query           EKSELEAFLNEIGDSVVLVEQDDLIKLHVHTNHPGQVLEKVIEFGEIVKVKIDNMKLQHEHVISTQPTKE
PF02734         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGVVAVSPGKGISDILKSLGVDVIVPGGQTMNPSFADLKAAVEQTHAKNVFLFPNNANVLLTAKQIAEAF
PF02734         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DDRRVIVVPTSFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF
PF02734         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDLEIYEGGQPHY
PF02734         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PYLMLLQ---------------------------------------------------------------
PF02734         ----------------------------------------------------------------------