[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36863.1


[Show Plain Result]

## Summary of Sequence Search
   1::220
   3::155  PF09704 0.0% 22  CRISPR-associated protein (Cas_Cas5) 
   1::220


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVLVFDVSAPYALFRRPYTTTSSYTLPFPPRTTLLGLVGCVLGYSTPERLDSAKVAVQIKNPLKFLRTG
PF09704         --tLllrlegplaswgrparkveresydvPtpSallGllaaalGirrdedalaalkpalrwavrvdrrge


                         -         -         *         -         -         -         -:140
query           TNFVETKKDKKASKRTRISLQLLKNPAYRVFFSWEDEDFERLKNLLEHSETIFTPYLGVASFIARLNYVG
PF09704         llrksdyhtvqvkltrrdeladrkqragtilsdreYladahfevaveaeedagklleeleralekpa..w


                         +         -         -         -         -         *         -:210
query           KYEATRVADFPCEVHTVVPNTVKLLPEPSHYLIFERVTRKMDKERNMLESAVYIFKRDLSPVKVEGGEVW
PF09704         plyLGrkeclvpvep-------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RVGEQNIVWM------------------------------------------------------------
PF09704         ----------------------------------------------------------------------