[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36879.1


[Show Plain Result]

## Summary of Sequence Search
   1::124
  14::104  PF02579 0.0% 45.5555555555556  Dinitrogenase iron-molybdenum cofactor 
   1::124


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
PF02579         -------------gskvdqhFGrapyFaiveveegnvkivenr.epeadeegggggklaellaaegvdvv


                         -         -         *         -         -         -         -:140
query           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH----------------
PF02579         ivggiGpralaaleaagikvykgaegtveealka------------------------------------