[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35126.1


[Show Plain Result]

## Summary of Sequence Search
   1::381
 203::377  1.3e-26 30.2% 0051509 00515091 1/1   -like ATPase domain                     
  83::380  2.1e-26 23.5% 0049498 00494981 1/1   -like ATPase domain                     
 204::379  3.9e-26 28.2% 0052961 00529611 1/1   -like ATPase domain                     
 203::378  5.9e-26 31.0% 0051456 00514561 1/1   -like ATPase domain                     
 203::375  2.7e-24 31.3% 0051732 00517321 1/1   -like ATPase domain                     
 204::383  3.3e-24 29.8% 0053028 00530281 1/1   -like ATPase domain                     
 200::375  1.3e-23 29.6% 0051804 00518041 1/1   -like ATPase domain                     
 203::382  5.3e-23 30.6% 0050912 00509121 1/1   -like ATPase domain                     
 203::376    4e-18 33.1% 0050671 00506711 1/1   -like ATPase domain                     
 202::344  1.9e-13 21.7% 0049353 00493531 1/1   -like ATPase domain                     
  75::200  3.9e-13 30.6% 0053029 00530291 1/1   -like ATPase domain                     
  80::197  5.9e-13 28.2% 0052960 00529601 1/1   -like ATPase domain                     
   8::78     6e-13 32.4% 0051455 00514551 1/1   ed helix" DNA-binding domain            
   9::68   1.9e-12 45.0% 0051507 00515071 1/1   ed helix" DNA-binding domain            
  83::201  3.7e-12 27.7% 0051457 00514571 1/1   -like ATPase domain                     
  81::217  1.4e-11 27.0% 0050670 00506701 1/1   -like ATPase domain                     
  82::203  1.7e-11 26.1% 0051731 00517311 1/1   -like ATPase domain                     
  77::201  2.8e-11 27.2% 0051508 00515081 1/1   -like ATPase domain                     
  83::198  3.2e-11 27.4% 0051805 00518051 1/1   -like ATPase domain                     
  12::168  7.6e-11 19.1% 0053261 00532611 1/1   ed helix" DNA-binding domain            
  83::197  9.6e-11 26.9% 0050911 00509111 1/1   -like ATPase domain                     
  12::100  3.9e-10 20.2% 0052364 00523641 1/1   ed helix" DNA-binding domain            
  13::109  5.2e-10 24.0% 0049944 00499441 1/1   ed helix" DNA-binding domain            
   9::323  9.5e-09 22.9% 0047243 00472431 1/1   -like ATPase domain                     
  11::70   1.1e-08 33.3% 0047283 00472831 1/1   ed helix" DNA-binding domain            
  12::139  1.4e-08 21.4% 0040266 00402661 1/1   ed helix" DNA-binding domain            
  12::73   6.8e-07 25.8% 0049384 00493841 1/1   ed helix" DNA-binding domain            
  17::72   1.2e-06 32.1% 0047585 00475851 1/1   ed helix" DNA-binding domain            
  11::70   1.3e-06 26.7% 0049173 00491731 1/1   ed helix" DNA-binding domain            
  17::72     4e-06 33.9% 0052641 00526411 1/1   ed helix" DNA-binding domain            
  17::72   4.6e-06 35.7% 0052644 00526441 1/1   ed helix" DNA-binding domain            
  12::61   4.9e-06 36.0% 0043164 00431641 1/1   ed helix" DNA-binding domain            
   9::71   6.7e-06 27.0% 0052159 00521591 1/1   ed helix" DNA-binding domain            
  17::72   7.9e-06 32.1% 0051708 00517081 1/1   ed helix" DNA-binding domain            
   8::86   8.3e-06 26.0% 0049777 00497771 1/1   ed helix" DNA-binding domain            
  17::72   9.4e-06 30.4% 0040586 00405861 1/1   ed helix" DNA-binding domain            
  17::72     1e-05 32.1% 0040517 00405171 1/1   ed helix" DNA-binding domain            
  17::72   1.1e-05 30.4% 0044258 00442581 1/1   ed helix" DNA-binding domain            
  17::72   1.1e-05 32.1% 0049308 00493081 1/1   ed helix" DNA-binding domain            
  17::72   1.1e-05 32.1% 0052514 00525141 1/1   ed helix" DNA-binding domain            
  17::72   1.2e-05 32.1% 0051528 00515281 1/1   ed helix" DNA-binding domain            
   8::73   1.3e-05 28.6% 0043935 00439351 1/1   ed helix" DNA-binding domain            
  17::72   1.3e-05 32.1% 0052801 00528011 1/1   ed helix" DNA-binding domain            
   4::66   1.7e-05 28.6% 0045862 00458621 1/1   ed helix" DNA-binding domain            
  80::196  1.7e-05 25.0% 0052166 00521661 1/1   -like ATPase domain                     
  18::82     2e-05 33.3% 0043062 00430621 1/1   ed helix" DNA-binding domain            
  17::72   2.1e-05 32.1% 0052640 00526401 1/1   ed helix" DNA-binding domain            
  17::72   2.3e-05 32.1% 0048695 00486951 1/1   ed helix" DNA-binding domain            
   8::91     3e-05 26.8% 0043095 00430951 1/1   ed helix" DNA-binding domain            
   9::68   3.3e-05 28.3% 0045968 00459681 1/1   ed helix" DNA-binding domain            
  17::72   3.5e-05 35.7% 0053037 00530371 1/1   ed helix" DNA-binding domain            
   7::76   3.7e-05 23.2% 0051024 00510241 1/1   ed helix" DNA-binding domain            
  15::69   3.9e-05 34.0% 0052579 00525791 1/1   ed helix" DNA-binding domain            
  12::86   4.1e-05 27.8% 0043669 00436691 1/1   ed helix" DNA-binding domain            
   7::58   7.1e-05 30.8% 0048605 00486051 1/1   ed helix" DNA-binding domain            
  13::73   0.00011 28.3% 0051302 00513021 1/1   ed helix" DNA-binding domain            
  17::72   0.00012 32.1% 0038701 00387011 1/1   ed helix" DNA-binding domain            
   1::64   0.00015 28.6% 0044139 00441391 1/1   ed helix" DNA-binding domain            
   4::69   0.00017 24.6% 0052506 00525061 1/1   ed helix" DNA-binding domain            
  13::64   0.00017 34.6% 0047523 00475231 1/1   ed helix" DNA-binding domain            
  15::72   0.00017 33.3% 0051444 00514441 1/1   ed helix" DNA-binding domain            
  17::72   0.00023 35.2% 0041905 00419051 1/1   ed helix" DNA-binding domain            
  17::72   0.00023 32.7% 0051521 00515211 1/1   ed helix" DNA-binding domain            
  17::72   0.00031 28.6% 0037861 00378611 1/1   ed helix" DNA-binding domain            
   8::78   0.00034 33.3% 0051170 00511701 1/1   ed helix" DNA-binding domain            
   1::62   0.00039 30.6% 0042770 00427701 1/1   ed helix" DNA-binding domain            
  10::89   0.00062 26.2% 0043758 00437581 1/1   ed helix" DNA-binding domain            
 205::376  0.00064 18.7% 0052165 00521651 1/1   -like ATPase domain                     
   7::68   0.00068 27.9% 0039384 00393841 1/1   ed helix" DNA-binding domain            
   9::59   0.00074 33.3% 0051026 00510261 1/1   ed helix" DNA-binding domain            
  17::72   0.00083 32.1% 0042156 00421561 1/1   ed helix" DNA-binding domain            
   1::381


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKA
00515091   1/1  ----------------------------------------------------------------------
00494981   1/1  ----------------------------------------------------------------------
00529611   1/1  ----------------------------------------------------------------------
00514561   1/1  ----------------------------------------------------------------------
00517321   1/1  ----------------------------------------------------------------------
00530281   1/1  ----------------------------------------------------------------------
00518041   1/1  ----------------------------------------------------------------------
00509121   1/1  ----------------------------------------------------------------------
00506711   1/1  ----------------------------------------------------------------------
00493531   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00514551   1/1  -------dlvrelnrslvlrllrrngpisraelakltgLspatvtkivseLleeglvlelgllesggggr
00515071   1/1  --------llldlnqllvlrllrengplsraeLarllglspatvtrivdeLeeaglveevgdpedgrr--
00514571   1/1  ----------------------------------------------------------------------
00506701   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00532611   1/1  -----------mmedlarllkaLgdptrlrILrlLl.egpltvseLaeelgisqstvsrhLkkLeeaGlv
00509111   1/1  ----------------------------------------------------------------------
00523641   1/1  -----------raaraliellaellkalgldptrlriLllLlengepltvseLaellglskstvsrhlkk
00499441   1/1  ------------mldemleelaelfkaLadptRlrILelLa.egeltvseLaellglsqstvsrHLkkLe
00472431   1/1  --------smlilGIDlGttntkaalvdedgeilaeasvp................pedalealleaike
00472831   1/1  ----------ldeleleilllllengplsiselaerlglskstvsrhlkkLeeagliervgllldrrklg
00402661   1/1  -----------iflllraarllikllgellkrlglsptrlriLalLaesdgpltvselaeelglskstvs
00493841   1/1  -----------llrllleelaellkalgldptrlriLllLlenggltvseLaeelglsrstvsrrlkrLe
00475851   1/1  ----------------lvLlaLaenggltvseLaerlglskstvtrlldrLekkGlvererdpeDrRavl
00491731   1/1  ----------ldeldlkilklllkngrlsvselaerlglsestvsrllkkLeekglikrigllldlrklg
00526411   1/1  ----------------rvLllLaenggltvseLaerlglskstltrlldrLekkGlvererdpeDrRrvl
00526441   1/1  ----------------lslsleslllldlldlllldlldmedpdldelelellfllrrlaralrrlldel
00431641   1/1  -----------srtrlliLllLlealegelsftelaealglsqstvsrhlkkLeelglver---------
00521591   1/1  --------leLdeldlkilellakdprlslrelaerlGlsegtvsrrlerLeekGlvervvvlvdrrklg
00517081   1/1  ----------------lvLlaLaenggltvseLaerlgiskstvtrllkrLekkGlverepdpeDrRrvl
00497771   1/1  -------kaLadptRlrIlrlLaeegeltvgeLaellglsqstvshhLkvLeeaGlverrr..egrrvyy
00405861   1/1  ----------------liLllLaenggltvseLaerlglskstltrllkrLekkglvererdpeDrRvvl
00405171   1/1  ----------------rvLllLaenggltvseLaerlglsrstvtrllkrLeekGlvererdpedrRavl
00442581   1/1  ----------------liLllLaedgeltvseLaellglspstlsrhLkrLeeaGlverrrdpedgrrvy
00493081   1/1  ----------------rvLlaLaenggltvseLaerlglskstvtrlldrLekkGlvererdpeDrRavl
00525141   1/1  ----------------lvLlaLaelggltvseLaerlglskstvtrlldrLekkGlvererdpeDrRvvl
00515281   1/1  ----------------lvLlaLaenggltvseLaerlglskstltrllkrLekkGlvererdpeDrRvvl
00439351   1/1  -------glgltplqlliLllLaegpgltvyelaerlggllslspgtvyrllkrLekeGlverrr...dr
00528011   1/1  ----------------rvLlaLaenggltvseLaerlglskstvtrlldrLekkGlvererdpeDrRvvl
00458621   1/1  ---lleltelledylklillllledgplsvseLaerlgvspptvsralkrLeedGlvererdggdr----
00521661   1/1  ----------------------------------------------------------------------
00430621   1/1  -----------------ildlLa.dgpltvaeLAerlglspsalsrlLrlLaslglvee....dgegrrv
00526401   1/1  ----------------lvLlaLaelnggltqseLaerlglskstvtrlldrLekkGlvererdpeDrRav
00486951   1/1  ----------------rvLlaLaelggglltvseLaerlglskstvtrlldrLekkglvererdpeDrRa
00430951   1/1  -------kaladptrlrilrlLae.gelsvgelaealglsqstvsrhLkvLeeaglvkrrr.egrrvyyr
00459681   1/1  --------lllderrlkillllledgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgkgyrl--
00530371   1/1  ----------------rvLlaLaelggpltvseLaerlglskstvtrllkrLekkGlvererdpeDrRrv
00510241   1/1  ------kelllgllqlliLalLae.gplygyelaklleellggllgisegtlypaLkrLekkglveryle
00525791   1/1  --------------ldlkeelcpvaraldllgdkwrlliLrlll.egplrfgeLarrlgiskstLsrrL-
00436691   1/1  -----------mllllllelleelaellkaladptrlrilrlLa.egelsvgeLaealglsqstvsrhLk
00486051   1/1  ------ltesledylllilllllengpvsvselaerlgvspstvtrlvkrLeekglve------------
00513021   1/1  ------------slrlliLglLae.gpmhgyelakeleerlggfwgispgtlypaLkrLeeeGlveseve
00387011   1/1  ----------------lvLllLaeeggelltvseLaerlglskstvtrllkrLekkglvererspeDrRv
00441391   1/1  vlgfvlsaalkaavelgildlLa.dgpltvaeLaaalgldpsllsrlLralvalglveededgr------
00525061   1/1  ---rivlelllgklrlliLalLae.gplhgyeLakrleelslgllpgispgtlypaLkrLeedGlvere-
00475231   1/1  ------------dleekilelLkeageplsaleiakelglpkkevnrlLyeLkkeglvvspkpp------
00514441   1/1  --------------lmllldlllllcpvaraldllgdkwrlliLrlll.dgplrfseLarrlpgisqstl
00419051   1/1  ----------------evllvLwekgpltvkelaeelgeeldlspstvttllkrLekkGlverekd..gr
00515211   1/1  ----------------liLrlll.egplrfseLarllpgisqgtltrrLkrLeedGlverevypedprrv
00378611   1/1  ----------------lvLllLaendeggltlkdlaellniskstvtrllkrLekkglverkrseeDrRv
00511701   1/1  -------lllllllllllllleelleelarllkaladptRlrILrlLa..gelsvselaellglsqstvs
00427701   1/1  lssalgelslsrdleqrvlellrelgegkaltakeLakelgvskstvnraLysLereglvvr--------
00437581   1/1  ---------elterqrlilellvelylkeggpvsvreLaellglgvSraTirrdLaeLeelGllervhgg
00521651   1/1  ----------------------------------------------------------------------
00393841   1/1  ------llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrrgg.gyr--
00510261   1/1  --------ldsddleekilelLkelgpltaleiakklglskakevnrvLyrLekeglvl-----------
00421561   1/1  ----------------liLllLaeaeeggltvkelaeklglskstvtrllkrLekkglvervrspeDrRv


                         -         -         *         -         -         -         -:140
query           VTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
00515091   1/1  ----------------------------------------------------------------------
00494981   1/1  ------------gyvlgiDiGgtnirvalvdldgevlarvriptpnp..fdeildaiaelleea..gldi
00529611   1/1  ----------------------------------------------------------------------
00514561   1/1  ----------------------------------------------------------------------
00517321   1/1  ----------------------------------------------------------------------
00530281   1/1  ----------------------------------------------------------------------
00518041   1/1  ----------------------------------------------------------------------
00509121   1/1  ----------------------------------------------------------------------
00506711   1/1  ----------------------------------------------------------------------
00493531   1/1  ----------------------------------------------------------------------
00530291   1/1  ----Pdaayvlgi..diggtkikvalvdldgevlarvriptpadldpealldaiaelieellaelgldls
00529601   1/1  ---------myvlgidiggtkikvalvdldgeilarvriptpadpealldaiaelidel........dil
00514551   1/1  pilllleg--------------------------------------------------------------
00515071   1/1  ----------------------------------------------------------------------
00514571   1/1  ------------pdaayvlgidiggtkiklalvdldgeilarlriptpaldpeavleaiaelieellael
00506701   1/1  ----------mkyvlGidiGgtkikaalvdldgevlarariptpglaeqdpeavldaiaelirellaeag
00517311   1/1  -----------alvlgidiggtkiklalvdldgeilarlriptpadldpeavldaiaelidellaelgl.
00515081   1/1  ------pdaayvlgidiggtkiklalvdldgevlarlriptpapdpeavldaiaelieellaelgldlsr
00518051   1/1  ------------yvlgidiggtkiklalvdldgeilarlriptpasdpeavldalaelidellaeag...
00532611   1/1  errrepedrggrrvyYrltekglallldllaelaealleeleellg.ellelleelleelaellelldel
00509111   1/1  ------------yvlgidiggtkikaalvdldgeilarlriptp...gpeavleaiaelikel....dil
00523641   1/1  LeeaGlverrrsegdgrkvyysltekgrel----------------------------------------
00499441   1/1  eaGlverrregrdrgrpekyYrltdeglallpdlleell-------------------------------
00472431   1/1  aleeagisfddidaiavtgqggglagldvvgl......................................
00472831   1/1  ----------------------------------------------------------------------
00402661   1/1  ralkrLeelGlvrrerspgdrrrvyysltekglillflerlrellekl..lelleelleellsglsdee-
00493841   1/1  eaG-------------------------------------------------------------------
00475851   1/1  ls--------------------------------------------------------------------
00491731   1/1  ----------------------------------------------------------------------
00526411   1/1  ls--------------------------------------------------------------------
00526441   1/1  lk--------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00521591   1/1  y---------------------------------------------------------------------
00517081   1/1  ls--------------------------------------------------------------------
00497771   1/1  rlndeglaallellle------------------------------------------------------
00405861   1/1  ls--------------------------------------------------------------------
00405171   1/1  ls--------------------------------------------------------------------
00442581   1/1  ys--------------------------------------------------------------------
00493081   1/1  ls--------------------------------------------------------------------
00525141   1/1  ls--------------------------------------------------------------------
00515281   1/1  ls--------------------------------------------------------------------
00439351   1/1  rrk-------------------------------------------------------------------
00528011   1/1  ls--------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521661   1/1  ---------mmklylGiDgGgTktkavlvdedgkilarakagttnplllgleealeaiaeaveealekag
00430621   1/1  yrltpvsrlLld----------------------------------------------------------
00526401   1/1  ll--------------------------------------------------------------------
00486951   1/1  vl--------------------------------------------------------------------
00430951   1/1  ltdeglaellelllellelie-------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00530371   1/1  ll--------------------------------------------------------------------
00510241   1/1  esegdr----------------------------------------------------------------
00525791   1/1  ----------------------------------------------------------------------
00436691   1/1  vLeeaglverrr..dg------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00513021   1/1  esg-------------------------------------------------------------------
00387011   1/1  vl--------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------
00514441   1/1  sr--------------------------------------------------------------------
00419051   1/1  rv--------------------------------------------------------------------
00515211   1/1  ey--------------------------------------------------------------------
00378611   1/1  vl--------------------------------------------------------------------
00511701   1/1  hhLkvL.e--------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00437581   1/1  agriptlkgyrlyvdkllk---------------------------------------------------
00521651   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00510261   1/1  ----------------------------------------------------------------------
00421561   1/1  vl--------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
00515091   1/1  --------------------------------------------------------------gldnflyl
00494981   1/1  lgigigvpgpvdddtgiltnlp...wg.fdlkdleealglpvvaleNDanaaalalllldedlealfgag
00529611   1/1  ---------------------------------------------------------------ldnfvyl
00514561   1/1  --------------------------------------------------------------gldnfvyl
00517321   1/1  --------------------------------------------------------------gldnvvyl
00530281   1/1  ---------------------------------------------------------------sdnlvyl
00518041   1/1  -----------------------------------------------------------Agkgvdnllyl
00509121   1/1  --------------------------------------------------------------gldnvvyl
00506711   1/1  --------------------------------------------------------------glgnvlyl
00493531   1/1  -------------------------------------------------------------ledlnlivv
00530291   1/1  rllgiGiavpgpvdldtgvvlnapnlgwrgvdlaelLeealglpvvvenDanaaalaEal----------
00529601   1/1  giGigvpGpvdldtgvillapnlpgwngvplaellellglpvllenDanaaalaEll-------------
00514551   1/1  ----------------------------------------------------------------------
00515071   1/1  ----------------------------------------------------------------------
00514571   1/1  gldlsrllgiGiavpGpvdletgvvlnapnlpwrgvdlaelLeealglpvlvenDanaaal---------
00506701   1/1  lsgrilgiGigvpglvdldtgvvllapnlgwndvdlaelleellglpvlvenDanaaalaEal.......
00517311   1/1  .iGiavpGpv..adgvvlllnapnlpgwrgvdlaelLeealglpvfvenDanaaalaE.lf..-------
00515081   1/1  llgiGiavpGpvdldtgvvlsapnlpgwrgvdlaelLeealglpvvvenDanaaalaEllf---------
00518051   1/1  rilgigigvpGpvdaetgvvllapnlgwrgvplaelLeerlglpvllenDanaaalaE------------
00532611   1/1  lerleelvelleelgymaellplgdg..------------------------------------------
00509111   1/1  giGigvpGpvdletgvvlyglitaanllgwrgvplkelLeealglpvvvenDanaaA-------------
00523641   1/1  ----------------------------------------------------------------------
00499441   1/1  ----------------------------------------------------------------------
00472431   1/1  ............................................................vndplaaala
00472831   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00475851   1/1  ----------------------------------------------------------------------
00491731   1/1  ----------------------------------------------------------------------
00526411   1/1  ----------------------------------------------------------------------
00526441   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00521591   1/1  ----------------------------------------------------------------------
00517081   1/1  ----------------------------------------------------------------------
00497771   1/1  ----------------------------------------------------------------------
00405861   1/1  ----------------------------------------------------------------------
00405171   1/1  ----------------------------------------------------------------------
00442581   1/1  ----------------------------------------------------------------------
00493081   1/1  ----------------------------------------------------------------------
00525141   1/1  ----------------------------------------------------------------------
00515281   1/1  ----------------------------------------------------------------------
00439351   1/1  ----------------------------------------------------------------------
00528011   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521661   1/1  ldlsldllavglglaGaid.........pllglilvpllkellellglpvlvenDa--------------
00430621   1/1  ----------------------------------------------------------------------
00526401   1/1  ----------------------------------------------------------------------
00486951   1/1  ----------------------------------------------------------------------
00430951   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00530371   1/1  ----------------------------------------------------------------------
00510241   1/1  ----------------------------------------------------------------------
00525791   1/1  ----------------------------------------------------------------------
00436691   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00513021   1/1  ----------------------------------------------------------------------
00387011   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------
00514441   1/1  ----------------------------------------------------------------------
00419051   1/1  ----------------------------------------------------------------------
00515211   1/1  ----------------------------------------------------------------------
00378611   1/1  ----------------------------------------------------------------------
00511701   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00521651   1/1  ----------------------------------------------------------------edgivv
00393841   1/1  ----------------------------------------------------------------------
00510261   1/1  ----------------------------------------------------------------------
00421561   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
00515091   1/1  tlgtGiGgGivlngkllrlGanglA.EiGhlpvdpdgplcgcgnrgclEtyaSgpallrlyrellglgll
00494981   1/1  kglddgvvlilglGtGigvaglvlngkllrgingeaGhighlpggdfdlalldclcgnpgclsleklasg
00529611   1/1  tlgtGiGggivlngkllrganglagEiGhllvdprcgnrgcletlaSgpallrlyrallgleg....lda
00514561   1/1  tlgtGiGgGivingkllrGanglagEiGhllvdpdgllcgcgrrgclEtyasgpallrlarellglgles
00517321   1/1  tlgtGiGggivlngkllrganglagEiGhlllppdgllcycgrrgcletlasgpallrlyrellg.dld.
00530281   1/1  tlgtgiGgGivlngkllrGanglageiGhllvdpdgplccletlasgpallrra..........egldae
00518041   1/1  tlgtGiGgGivlngkllrganglagEiGhlpvpllralelaldpdgplcgcgnrgclEtyaSgpallrla
00509121   1/1  tlgtGiGgGivingkllrGa..lagEiGhllvplldpdgplclcgnrgvcletlasgpal..........
00506711   1/1  tlGtGiGggiildgkllrg.....gElGhl...cgnrgclealasgpalvr...................
00493531   1/1  hLGtGvsggailnGksvdtsmglpleglvmgtrsgdldpgcglylcletgasatelvrllnkksgllgls
00530291   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00514551   1/1  ----------------------------------------------------------------------
00515071   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00506701   1/1  .......---------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00532611   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00499441   1/1  ----------------------------------------------------------------------
00472431   1/1  agllgageg.....lvldiGggttdvsivkdgklvvgalggdgelgggllddaiarllglgfpgaiella
00472831   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00475851   1/1  ----------------------------------------------------------------------
00491731   1/1  ----------------------------------------------------------------------
00526411   1/1  ----------------------------------------------------------------------
00526441   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00521591   1/1  ----------------------------------------------------------------------
00517081   1/1  ----------------------------------------------------------------------
00497771   1/1  ----------------------------------------------------------------------
00405861   1/1  ----------------------------------------------------------------------
00405171   1/1  ----------------------------------------------------------------------
00442581   1/1  ----------------------------------------------------------------------
00493081   1/1  ----------------------------------------------------------------------
00525141   1/1  ----------------------------------------------------------------------
00515281   1/1  ----------------------------------------------------------------------
00439351   1/1  ----------------------------------------------------------------------
00528011   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521661   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00526401   1/1  ----------------------------------------------------------------------
00486951   1/1  ----------------------------------------------------------------------
00430951   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00530371   1/1  ----------------------------------------------------------------------
00510241   1/1  ----------------------------------------------------------------------
00525791   1/1  ----------------------------------------------------------------------
00436691   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00513021   1/1  ----------------------------------------------------------------------
00387011   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------
00514441   1/1  ----------------------------------------------------------------------
00419051   1/1  ----------------------------------------------------------------------
00515211   1/1  ----------------------------------------------------------------------
00378611   1/1  ----------------------------------------------------------------------
00511701   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00521651   1/1  ilGTGsgaggidpd....grlcrcGgwGhllgdegSgywigrralravlraldgr..gpapalptaltea
00393841   1/1  ----------------------------------------------------------------------
00510261   1/1  ----------------------------------------------------------------------
00421561   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIAN
00515091   1/1  slldlegldaeeifeaaragdplaleildefaralaralanlinlldpeaivlgGglsraldlllealre
00494981   1/1  pgllrllrllleklglegslldaeevfeaaragfdplalaildraarllaralanlalnlldpdgvvlgG
00529611   1/1  eelfeaalagdplalealdrfarylaralanlvllldpeaivlgGgvsa.gdlllealrealaellrllp
00514561   1/1  llsglealdaeeifeaaragdplaleildeaadalaralanlinlldpeaivlgGglsrlgdllleaire
00517321   1/1  ....aeeifeaaragdplalevldefaralaralanlillldpeaivlgGglsrlgd.llealrealakl
00530281   1/1  elfeaaragdplalevldeaarylaralanlinlldpelivlgGgvsrlgdlllealrealarlllp.ll
00518041   1/1  ralgg.....elldaeeifeaaeagdplalealdefarylaralanlillldpelivlgGgvsaa.dlll
00509121   1/1  .........eeifeaaragdplalevldeaarylaralanlinlldpelivlgGgvsna.ellldllrea
00506711   1/1  ...........alavldefarylaralanlillldpelivlgGgvsaagdlllellre...........d
00493531   1/1  gssdarevleaaeegdelAklaldafayrlakyigslaavldgepdaivltGGigensellrea------
00530291   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00514551   1/1  ----------------------------------------------------------------------
00515071   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00506701   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00532611   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00499441   1/1  ----------------------------------------------------------------------
00472431   1/1  sglalvrlkgldlpfsglk...itralfegleia.dilaalle---------------------------
00472831   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00475851   1/1  ----------------------------------------------------------------------
00491731   1/1  ----------------------------------------------------------------------
00526411   1/1  ----------------------------------------------------------------------
00526441   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00521591   1/1  ----------------------------------------------------------------------
00517081   1/1  ----------------------------------------------------------------------
00497771   1/1  ----------------------------------------------------------------------
00405861   1/1  ----------------------------------------------------------------------
00405171   1/1  ----------------------------------------------------------------------
00442581   1/1  ----------------------------------------------------------------------
00493081   1/1  ----------------------------------------------------------------------
00525141   1/1  ----------------------------------------------------------------------
00515281   1/1  ----------------------------------------------------------------------
00439351   1/1  ----------------------------------------------------------------------
00528011   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521661   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00526401   1/1  ----------------------------------------------------------------------
00486951   1/1  ----------------------------------------------------------------------
00430951   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00530371   1/1  ----------------------------------------------------------------------
00510241   1/1  ----------------------------------------------------------------------
00525791   1/1  ----------------------------------------------------------------------
00436691   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00513021   1/1  ----------------------------------------------------------------------
00387011   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------
00514441   1/1  ----------------------------------------------------------------------
00419051   1/1  ----------------------------------------------------------------------
00515211   1/1  ----------------------------------------------------------------------
00378611   1/1  ----------------------------------------------------------------------
00511701   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00521651   1/1  lleylglsdlaellaflysappkaviAslaplvaeaaeegDplAlailreaarelarllaavinlldpel
00393841   1/1  ----------------------------------------------------------------------
00510261   1/1  ----------------------------------------------------------------------
00421561   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VLIRDTIFKEISPSLVGGNVLAIEEFLRQIT---------------------------------------
00515091   1/1  alaklllpglledppivlatlgd.dag-------------------------------------------
00494981   1/1  gvaralpdlllspllrealeekllfsallg----------------------------------------
00529611   1/1  lllelpeivlatlgd.dagllGaaalald-----------------------------------------
00514561   1/1  alaklllsgllelppivlatlgd.dagl------------------------------------------
00517321   1/1  llps..dppivlatlgd.dagllGA---------------------------------------------
00530281   1/1  lppivlatlgd.dagllGAaalaldallellll-------------------------------------
00518041   1/1  ealrealaelllpalllpeivlael---------------------------------------------
00509121   1/1  lrellldylrlplllellptlivlaklgd.da--------------------------------------
00506711   1/1  lkivlaklgn.dagllGAaalalekl--------------------------------------------
00493531   1/1  ----------------------------------------------------------------------
00530291   1/1  ----------------------------------------------------------------------
00529601   1/1  ----------------------------------------------------------------------
00514551   1/1  ----------------------------------------------------------------------
00515071   1/1  ----------------------------------------------------------------------
00514571   1/1  ----------------------------------------------------------------------
00506701   1/1  ----------------------------------------------------------------------
00517311   1/1  ----------------------------------------------------------------------
00515081   1/1  ----------------------------------------------------------------------
00518051   1/1  ----------------------------------------------------------------------
00532611   1/1  ----------------------------------------------------------------------
00509111   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00499441   1/1  ----------------------------------------------------------------------
00472431   1/1  ----------------------------------------------------------------------
00472831   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00475851   1/1  ----------------------------------------------------------------------
00491731   1/1  ----------------------------------------------------------------------
00526411   1/1  ----------------------------------------------------------------------
00526441   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00521591   1/1  ----------------------------------------------------------------------
00517081   1/1  ----------------------------------------------------------------------
00497771   1/1  ----------------------------------------------------------------------
00405861   1/1  ----------------------------------------------------------------------
00405171   1/1  ----------------------------------------------------------------------
00442581   1/1  ----------------------------------------------------------------------
00493081   1/1  ----------------------------------------------------------------------
00525141   1/1  ----------------------------------------------------------------------
00515281   1/1  ----------------------------------------------------------------------
00439351   1/1  ----------------------------------------------------------------------
00528011   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521661   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00526401   1/1  ----------------------------------------------------------------------
00486951   1/1  ----------------------------------------------------------------------
00430951   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00530371   1/1  ----------------------------------------------------------------------
00510241   1/1  ----------------------------------------------------------------------
00525791   1/1  ----------------------------------------------------------------------
00436691   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00513021   1/1  ----------------------------------------------------------------------
00387011   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00475231   1/1  ----------------------------------------------------------------------
00514441   1/1  ----------------------------------------------------------------------
00419051   1/1  ----------------------------------------------------------------------
00515211   1/1  ----------------------------------------------------------------------
00378611   1/1  ----------------------------------------------------------------------
00511701   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00521651   1/1  llgaeslpvvlgGgvaragdllldal--------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00510261   1/1  ----------------------------------------------------------------------
00421561   1/1  ----------------------------------------------------------------------