[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35173.1


[Show Plain Result]

## Summary of Sequence Search
   1::322
   4::321  1.4e-68 41.2% 0040409 00404091 1/1   ransporter involved in vitamin B12 upta 
   1::322


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKLVFPILILSFLLGIFFGSVPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVGAGLSIVGNSF
00404091   1/1  ---llllllllllllslllgavlislsdvl.......dsllllilldlrlprllaallvGaalavaGall


                         -         -         *         -         -         -         -:140
query           QNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFSMIASLLTLLIARKEGRFPVT
00404091   1/1  qtltrNpLadPsilGissgallgavlaill..lpgvalalllplaaflgallaallvallar..gglspl


                         +         -         -         -         -         *         -:210
query           TIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFSGSTWEDVLFYLMVVIPFLLYSLIFSKHLNA
00404091   1/1  rllliGialsallsalltllllladpealqsllfwlfGsllgvswsdlllllpl.llvlllllllarpln


                         -         -         -         +         -         -         -:280
query           MALGEEEAFILGVSVERLKVVTFLFGNLITAFLVSRSGVIGFVGLIVPHISRYLVGPNFLKSVLSSLIVG
00404091   1/1  llslgeelArslGvnvrrlrllllllvallvaaavalvGpilfvGLlvPhlarllvgsdhrlllplsall


                         -         *         -         -         -         -         +:350
query           GVLLTLCDTAARTFFSPTELPVGVVTALIGAPFLAFLMKRGV----------------------------
00404091   1/1  GallllladllgrllllplelpvgvvtaligapfFlylllr-----------------------------