[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35255.1


[Show Plain Result]

## Summary of Sequence Search
   1::771
 183::425    2e-08 22.0% 0047592 00475921 1/1   /beta-Hydrolases                        
 186::424  2.1e-08 19.0% 0047879 00478791 1/1   /beta-Hydrolases                        
 189::324  7.6e-07 27.1% 0042339 00423391 1/1   /beta-Hydrolases                        
 184::453  5.2e-06 20.3% 0037239 00372391 1/1   /beta-Hydrolases                        
 161::397    6e-06 19.1% 0049128 00491281 1/1   /beta-Hydrolases                        
 190::318  8.7e-06 23.4% 0044560 00445601 1/1   /beta-Hydrolases                        
 183::426  1.2e-05 22.3% 0053348 00533481 1/1   /beta-Hydrolases                        
 182::335  7.3e-05 24.6% 0046221 00462211 1/1   /beta-Hydrolases                        
 158::407  7.5e-05 18.1% 0048194 00481941 1/1   /beta-Hydrolases                        
   1::771


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSFLKKLLEIVLKRKILFFTLVFISITVFFLLIFFQKEGSLKIGKEGAESGFINLRVEIPPGAFGKQKVL
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KITRLSDEERKLYPDVFVGDLYRVEFADGVDEFALKPIRLKYYFDAKYLRGENYNNLTFAYATEDGGYRI
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IPGSMIGKDERGYYVEAFTYHLSVFGVVLRSAGFQKHGIRLLREAVNSSGPAVLLVPGEDPTFEGVVKDN
00475921   1/1  ------------------------------------------lll.pgsgppvvlvHGlggsar......
00478791   1/1  ---------------------------------------------ypgpgsgppvvlvHGlggssrswrp
00423391   1/1  ------------------------------------------------dgppvllvHGlggssy......
00372391   1/1  -------------------------------------------yrgdgegppvvlvHGlggsasswl..l
00491281   1/1  --------------------alpvevetvtvpvdgdclhl.vylPa.....lPavvvllhGgggsagsas
00445601   1/1  -------------------------------------------------gppvllvhGlggsssshwwrp
00533481   1/1  ------------------------------------------erype....pgppvvllHGlggsae...
00462211   1/1  -----------------------------------------l.ppgagsgppvvllHGlggsseswll..
00481941   1/1  -----------------gslllalllrllellkldlllellllllklellleplevefvdvdglrlhy.p


                         -         -         -         +         -         -         -:280
query           NIWETIFPDRTIMTYEYALYEPRSLAYSEMYRSFIEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGT
00475921   1/1  .........................swrpggdyWpglldslaeaLaeaGyrvialDlGhGrSgadysled
00478791   1/1  gldywlgpkdslaeaLakaGyrVialDlr...................p.sdysledlaedlaylkgGtv
00423391   1/1  .sw......rslaelLaaalpGyrvialdlrghGlsdkp..geysledlaad.leallealg.ekvhlvG
00372391   1/1  dywrslaeaLaeaGyrviavdlrghGrsPysledlaadlealldalgie....................k
00491281   1/1  lelyrglaralaarGyivvapdyrGfggsgpppad.........gnyglldqlaaaaldwlranlgidpg
00445601   1/1  ....laealasa...gyrvvaldlpghgls..............slddwvedllalldalg.epvvlvGh
00533481   1/1  ..........................swwlpsswrplaeaLaeaGyrviapdlrGhGgSdgppysledla
00462211   1/1  .......................lgywrplaeaLaerGyrviapDlrGhGgSdgppysledlaedlaall
00481941   1/1  ppgggsgplpvvllHG....gggssgsp.swrplaraLaa.gyrviapDlrGhGeSdgppdrlgpysled


                         -         *         -         -         -         -         +:350
query           GGLIVLRMLQRHPEVNNVRKVVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIR
00475921   1/1  laddl.ggfwdfsfdeiakyDlpalideaialldalglegkvilvGHSmGGlvalyaaarlpeegpeeie
00478791   1/1  dywdfsfdeiglydlpaaiealldalglelkvvlvGHSmGGlvalaaaarlgpelveklivvdiapvlyd
00423391   1/1  hSmGGlvaralaarlper.kvkslvllapPhlgspladllplll--------------------------
00372391   1/1  vvlvGHSmGGlvalyaaarrPd..rvaslvllgpphlgspladllprllpllllealllalagllgalls
00491281   1/1  rvvlvGhSlGGalalllalryPdl..vaglvllsgplpgsaaala.....................elpe
00445601   1/1  SlGglvalrlaarlpelarvaglvllapalplleglpe--------------------------------
00533481   1/1  edlaalldalgiekvvlvGhSmGGlvalelaarype..rvkglvllappldgspladallellrkallal
00462211   1/1  dalgiekvvlvGhSmGGlvalalaarype..rvkglvllappldgsaladallel---------------
00481941   1/1  laadllall.rdalgid..pvvlvGhSmGGllalalaarlaarype..rvkglvllsppldlsellesll


                         -         -         -         -         *         -         -:420
query           NLIDTLGEVVQEILPDSQLVKELGGFSRNDVEIVSICGDTPPYGVDVSGTELERFYPEFVKGRGDGFVSI
00475921   1/1  algsggpklspllksypdr..vkglvllapPhlGspladllrsllplllllpllaellrsllglllllll
00478791   1/1  grlawyper..vkglvllapPhlGspladlll.............allpllallllaallsfllrll.al
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  lllgpelllqilldalsdlttellaaflellpgsgflaallhgaqlvpgvrygsylrllllnleldplad
00491281   1/1  allallggldlelllgpvllgdlllldpldlledlkaikvpvliihG-----------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  llkllgllpe..................lllllallrrldllealkki...kvlttegallfnakyPngg
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  rlllarlllddlleallgglladpellrdlsplpl......................-------------


                         -         -         +         -         -         -         -:490
query           QSCRVGKVEQLSGNFYDLYSREENVAYIRELLKYEVQVFSGFRSDDYEEYLPSKNPELSEESAQKVVEVK
00475921   1/1  ldfdl-----------------------------------------------------------------
00478791   1/1  lsfl------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  lrkikvPvllihgenDglvppesarlgfvlrla-------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  leapgs----------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ETEGTEFPVLPVNILFENFLERIRSLELSSYLSGALVGKEVYIATESGVFAWDKKVLDKKIEFFKKIEDY
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ASFVGEGDIFIIDNIGIKKYAPFPLVGDISDALITRNAIIYARVVPGGVRYYLFRNGAEKLIATSPGTTV
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RMKSENGNYLLITDGEVVAIGSDFKEKGRVLSSLFGEKVKIVDASFKDDAFYILLNDGSIAFVSSSRSET
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           KNYGLAVPKKVLNFQGRILVVYDGVILDLSAGKAQRFDRGIIDVFPGNESLFIVFDEKVRVSVEEWWLSK
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           D---------------------------------------------------------------------
00475921   1/1  ----------------------------------------------------------------------
00478791   1/1  ----------------------------------------------------------------------
00423391   1/1  ----------------------------------------------------------------------
00372391   1/1  ----------------------------------------------------------------------
00491281   1/1  ----------------------------------------------------------------------
00445601   1/1  ----------------------------------------------------------------------
00533481   1/1  ----------------------------------------------------------------------
00462211   1/1  ----------------------------------------------------------------------
00481941   1/1  ----------------------------------------------------------------------