[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35418.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
   1::180  3.7e-39 32.8% 0041687 00416871 1/1   e-like                                  
   2::188  3.9e-37 35.3% 0041997 00419971 1/1   e-like                                  
   6::142  2.5e-35 33.6% 0048919 00489191 1/1   e-like                                  
   4::175  7.8e-35 33.3% 0051755 00517551 1/1   e-like                                  
   1::160    4e-31 38.2% 0051163 00511631 1/1   e-like                                  
   6::142  6.4e-31 32.8% 0048249 00482491 1/1   e-like                                  
   9::160  9.1e-31 35.4% 0050136 00501361 1/1   e-like                                  
  12::145  1.6e-28 33.6% 0036900 00369001 1/1   e-like                                  
   4::164  1.7e-27 33.1% 0046909 00469091 1/1   e-like                                  
  11::146    9e-27 27.2% 0046852 00468521 1/1   e-like                                  
   5::183  1.6e-26 28.1% 0035791 00357911 1/1   e-like                                  
   6::146  3.3e-26 27.0% 0046155 00461551 1/1   e-like                                  
   1::143  1.3e-25 33.3% 0040356 00403561 1/1   e-like                                  
  28::188  1.9e-25 28.8% 0038588 00385881 1/1   e-like                                  
   4::160  2.5e-25 30.8% 0041991 00419911 1/1   e-like                                  
  25::146  1.2e-23 37.7% 0048678 00486781 1/1   e-like                                  
  27::153  1.4e-22 30.7% 0050349 00503491 1/1   e-like                                  
  17::166  2.9e-22 24.8% 0047030 00470301 1/1   e-like                                  
  22::153  2.4e-21 32.6% 0044334 00443341 1/1   e-like                                  
  36::149  6.8e-21 34.2% 0034851 00348511 1/1   e-like                                  
  28::145    7e-21 32.2% 0038017 00380171 1/1   e-like                                  
  14::145    8e-21 36.2% 0048493 00484931 1/1   e-like                                  
  32::165  8.9e-21 30.8% 0041576 00415761 1/1   e-like                                  
  31::145  1.5e-20 33.9% 0050151 00501511 1/1   e-like                                  
  26::149  3.1e-20 32.3% 0041489 00414891 1/1   e-like                                  
  26::146  4.2e-19 30.6% 0051301 00513011 1/1   e-like                                  
   1::148  5.4e-15 24.3% 0036560 00365601 1/1   e-like                                  
  44::145  4.3e-14 35.6% 0047309 00473091 1/1   e-like                                  
  30::145  1.4e-13 26.7% 0051105 00511051 1/1   e-like                                  
  43::149  2.5e-13 33.3% 0050105 00501051 1/1   e-like                                  
  39::146  2.1e-12 30.6% 0042536 00425361 1/1   e-like                                  
  54::136  2.7e-11 36.1% 0052114 00521141 1/1   e-like                                  
  56::136    1e-09 28.8% 0049833 00498331 1/1   e-like                                  
  42::145    5e-09 30.7% 0035468 00354681 1/1   e-like                                  
  58::136  2.7e-08 29.1% 0046350 00463501 1/1   e-like                                  
 103::163  0.00024 27.9% 0050435 00504351 1/1   e-like                                  
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
00416871   1/1  lvakllldagalkfgiftlpsgpisgifvdllkllvdpellrrlaeelaeriagldidvvvgvprgGipl
00419971   1/1  -epitakllaellleagalrvgefdlhsgqispiffdi.kvlldpellralgrllaelirelgldidvvv
00489191   1/1  -----taviPylgyarqdrkllpleaisaklvgrfildsgkksiifvdlrkllsdpellllladllaeli
00517551   1/1  ---Pitaklvadlllelladriltfglftlksglqspgffdirvllldpellrllarllaelikdlglei
00511631   1/1  lkellelireigalpkggfll........fidilsllldpellrllgellaerlaglkidvvvgveagGi
00482491   1/1  -----cavipylgyarqdrcakclehplaklklrflldsgkpsiifidllkllgdpellealadllaeli
00501361   1/1  --------elleldllkfgdfvltyglhsdsyidffkvlvdpellrrlarllaerlkd.didvvvgvplg
00369001   1/1  -----------kacafellyydlpdsqiigffkydvdpllgrllaeelaerlkdldidvvvgvprgGipl
00469091   1/1  ---lvaelllelladriltvglfplksg....lyfditkllldpelllelarllaeeiaellpgldidvv
00468521   1/1  ----------Pylgyarqdrkclpgepisaklvalllylagldrlltsdkhsgqlqlalisaeeileair
00357911   1/1  ----dlhagqilgffdfpldslcispyyyddrpdllldpeliyelvrrlaeelaeklggkpdvvvgvprg
00461551   1/1  -----rqdrklcgrelisaklvadllallgydfvltsdlhslkyqdifillvdilallailaaiiekdlg
00403561   1/1  dlllelladriltvglf....gkpgflyidilkllgdpellrlladllaerlkdldidvvvgiprgGfpl
00385881   1/1  ---------------------------yldffkllvdpeliralarllaeeilelyggepdvvvgvprgG
00419911   1/1  ---rvltldlllkqirffldspvdgllyiditkllldpellrelarllaeelaellpleidvvvgiprgG
00486781   1/1  ------------------------Pkpyiafrdilldlleirealrrlaellaerlkglelldlgkpdvv
00503491   1/1  --------------------------rpdvlldgedirelgrllarelaedlalllveveglkpdvvvgi
00470301   1/1  ----------------rcifedlyfarpdsffdgpvvylllarllaelarel.dleadvvvgvplggipl
00443341   1/1  ---------------------gaqsdiffdge...lvrdlarllaeeiaerlkgldpdvvvgiprgGvpl
00348511   1/1  -----------------------------------lirdlarlladeiaerlkglkpdvvvgilrgGvpl
00380171   1/1  ---------------------------Yfdiqgllidpedilaaiellaeeiaeklkgglepdvvvgvpr
00484931   1/1  -------------alkrvsaldiplvkplltylrddrtpggdfrlgsgrlstlllyealfdlpvddleal
00415761   1/1  -------------------------------ltllldpeqiqalidelaeklkelykidvvvgvlrgGlp
00501511   1/1  ------------------------------ifkllvdpelilrlgrllaeeikdlkpdvvvgvprgGfpl
00414891   1/1  -------------------------diipllldyevirelgrllaeeiaerlkglkpdvvvgiprgGfpl
00513011   1/1  -------------------------lhyfdiqklllspedileairllaeeiaedlggkpdvvvgvlrgG
00365601   1/1  lrepitaklvadlllragadflipgdlhvdisdlllswevikalirelaeeiaedykdgvepdvivgvlr
00473091   1/1  -------------------------------------------laelllalr.glkqlvvvgilrgGvpl
00511051   1/1  -----------------------------rilpleeievetplgatligellkdlkklvvvsilrgGlpl
00501051   1/1  ------------------------------------------plaeelaelr.glkqlvvvgilrgGvpl
00425361   1/1  --------------------------------------ydrlldvllseeqiqgfidiladelaedylll
00521141   1/1  -----------------------------------------------------dlendvvvgpdrggvpr
00498331   1/1  -------------------------------------------------------d.dvvvgvdrggvpl
00354681   1/1  -----------------------------------------dtpvdnlyagvldldnlvvVsilrgGvll
00463501   1/1  ---------------------------------------------------------ndvvvgpddggvp
00504351   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
00416871   1/1  aaalaralgvplvivrkkaklpgddtlsvgyvlerstgvleillilgalvegkrVllVDDviatGgTlra
00419971   1/1  gvplgGiplaaalaralglplnrgvpfvfirkerkeygevvllig..lvkgkrVllVDDvittGgTlraa
00489191   1/1  kelllkidvvvgvelgGiplAaalalrlglplvivrkrrklpgttvviellyryeleygavtlelklgal
00517551   1/1  dvvvgpdagGiplaaalalalgvplvfvrkerkghgeveliega.lvkgkrVlivDDvitTGgTllaaae
00511631   1/1  plaaalaralgvplvfvrkegklhgegrtiegsvysrleygvdllllsldallkgkrVlivDDvlatGgT
00482491   1/1  kellldidvvvgvplrGfplaaalalrlglplvivrkkrklpgtrvtieglylselergpnllllklpal
00501361   1/1  GfplaaalaralglplvivrkrrkyvlpgfiglssysrdygvggalellkgllgdvegkrVllVDDvitt
00369001   1/1  aaalaralgvplvivrkrrkyygrtqiglgreerekgvrlkllpldadvkgkrVllVDDviatGgTlraa
00469091   1/1  vgiergGiplaaalaralgvplvlvrkkgklhgttlsveyrlenvegalklpkda.lvkgkrVllVDDvl
00468521   1/1  elaeeieddigpkplvvvgilrgGfnfaallaralglpliiilkvdllprvrltitqssyyrktrskgvv
00357911   1/1  GvplaaalaralgvplvivrkrrklpvdflsvssyvgrtliegnvilrlrldgdvkGkrVllVDDvidTG
00461551   1/1  pkplvvvgilrgGfpfaaalarelglplviirkvgklprvtvtisqsslygktrsegvvvilldldgdlk
00403561   1/1  aaalaralgvplvivrkkrklpvqvillsyeleygldvafelklp.advkgkrVllvDDvlaTGgTllaa
00385881   1/1  vplaaalaralgvplvivrkrrksygdterrgnvkilkdlpgdvegkrVllVDDvidTGgTlraaaelLk
00419911   1/1  fplaaalaralgvplvlvrkrrklpgttlsreerlenlkvalels.lgadvegkrVllVDDvlaTGgTlr
00486781   1/1  vgilrgGvplaaalaralgllgvpvplgfllvssyrdetrelgvvrlleglpadvkgkrVllVDDviaTG
00503491   1/1  prgGvplaaalaralglplvlvrklgvlgitfyrdeqkllgrgavleglklpfdvegkrVllVDDvltTG
00470301   1/1  AaalaralgiplaivlkrnryvgrtfirpsqelrekgvrvklnalvglveGkrVllVDDvittGtTlraa
00443341   1/1  aaalaralglplvivrkvgklgrtryrdeqkelslgerlkllrlpadlkgkrVllVDDvidTGgTlraai
00348511   1/1  aaalaralgvplvivrkvgklgvtsytddqyalergegnliigfdlpgdvkgkrVllVDDviaTGgTlra
00380171   1/1  gGvplaaalaralgvplaivrkrrksyggtfslsgeleilldlrgdvkgkrVllVDDvidtGgTlraaae
00484931   1/1  tplaeelaell.dlkidvvvgilrgGlplaaglaralpgaplgfirkrrkgatlgpvleygklpgdv.kg
00415761   1/1  laaalaralgvplvivrkvgkypetgnvklvldldad.vegkrvliVDDiidTGgTllaaaellkeagak
00501511   1/1  aaalaralgiplvivlkrrkytgetlelggvvlllnldgdvkgkrvllVDDvidTGgTlraaaelLkeag
00414891   1/1  aaalaralglplggklpvgfvrkerylegglsrlerlknvlgafklpadlkgkrVllVDDvitTGgTlra
00513011   1/1  vplaaalaralglplavgfkrrksygddlstlgeverlkdlpgdvegkdVllVDDvidTGgTlraaaeaL
00365601   1/1  gGlpfaallarelgvplavdrkrvksyggtrstgelkilkdldgdlegkkVLiVDDiidtGgTllaaael
00473091   1/1  aaalaralpgaplgfvrkrrklpglgpvleylllpgdvegrrVllvDDvlaTGgTllaaieaLkeaGakv
00511051   1/1  aaglarllpsapvgfilirrygetvvevllelepvlyylklpgdilkgknVllvDdmiaTGgTllaaiel
00501051   1/1  aaalaralpgaplgiirkrrkeyglgpvliyldlpgdvegrrVllvDDvlaTGgTllaaaelLkeaGakv
00425361   1/1  dyiglepdvvvgvlrgGvvfaadlaralgllglplpldfidksryggdtsslgnvvivkdligdvegkhV
00521141   1/1  aaaladalglplavvlkrrkragvvpilragllrldgvllllsylrelerlgnveellrlvgdvkg----
00498331   1/1  aagladllglplavlrkrryedgvvrklnlvgdvkgkrVllvDDiidtGgTllaaadaLreagAke----
00354681   1/1  aaalakllgdaplgfilirrdektlepvlyylklpgdv...kgrrVllvDdmlaTGgTllaAielLkelG
00463501   1/1  raalladrlglplavilkrrrslgvvrklnivgdvkgkrvllvDDiidtGgTllaaaeaLreagAk----
00504351   1/1  --------------------------------gktVllVDDvidTGgTlraaldaLrelgaksvvaavlv


                         +         -         -         -         -         *         -:210
query           DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK-----------------------
00416871   1/1  aielLreaGakvvgvavlvdkpggrellilpdvpvislpt------------------------------
00419971   1/1  aelLreaGakvvgvavlvdrpelggpaiedleellvtigvpvlsllsl----------------------
00489191   1/1  vk--------------------------------------------------------------------
00517551   1/1  llkeaGaevvgvavlvdllsggarerledagipvl-----------------------------------
00511631   1/1  llaaiellkeaGakvvgvav--------------------------------------------------
00482491   1/1  vk--------------------------------------------------------------------
00501361   1/1  GgTlraaaelLkeaGakvvg--------------------------------------------------
00369001   1/1  ielLr-----------------------------------------------------------------
00469091   1/1  aTGgTllaaaellkeaGakvvgva----------------------------------------------
00468521   1/1  villdl----------------------------------------------------------------
00357911   1/1  gTlraaaelLreaGakvvgvavlvdkpsgravdilpdyygiev---------------------------
00461551   1/1  GkhVll----------------------------------------------------------------
00403561   1/1  iel-------------------------------------------------------------------
00385881   1/1  eagakvvgvavlvdkpsggaelklk.pdyvglevptdfvvgypldyfe----------------------
00419911   1/1  aaaelLkeaGakvvgvavlv--------------------------------------------------
00486781   1/1  gTlraa----------------------------------------------------------------
00503491   1/1  gTlraaidaLrea---------------------------------------------------------
00470301   1/1  aeaLreaGAkevhvavlvprlsgpav--------------------------------------------
00443341   1/1  elLreaGrakvvg---------------------------------------------------------
00348511   1/1  aidlLkeag-------------------------------------------------------------
00380171   1/1  lLkea-----------------------------------------------------------------
00484931   1/1  krVll-----------------------------------------------------------------
00415761   1/1  vvgvavlldkppdyagerlpdefvv---------------------------------------------
00501511   1/1  akvvk-----------------------------------------------------------------
00414891   1/1  aielLreaG-------------------------------------------------------------
00513011   1/1  keagak----------------------------------------------------------------
00365601   1/1  Lkeagaks--------------------------------------------------------------
00473091   1/1  vgvav-----------------------------------------------------------------
00511051   1/1  Lkkag-----------------------------------------------------------------
00501051   1/1  vivavlva.-------------------------------------------------------------
00425361   1/1  llVDDi----------------------------------------------------------------
00521141   1/1  ----------------------------------------------------------------------
00498331   1/1  ----------------------------------------------------------------------
00354681   1/1  akvvr-----------------------------------------------------------------
00463501   1/1  ----------------------------------------------------------------------
00504351   1/1  lspralrrlpisadvvglntppl-----------------------------------------------