[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35545.1


[Show Plain Result]

## Summary of Sequence Search
   1::614
  19::611 7.3e-107 38.3% 0050299 00502991 1/1   lasmic binding protein-like II          
  16::614   8e-106 32.7% 0047567 00475671 1/1   lasmic binding protein-like II          
  24::611 1.2e-102 36.6% 0046378 00463781 1/1   lasmic binding protein-like II          
  19::613 2.4e-102 38.2% 0051046 00510461 1/1   lasmic binding protein-like II          
  22::611 6.5e-100 36.8% 0044486 00444861 1/1   lasmic binding protein-like II          
  24::611  1.5e-96 37.6% 0049916 00499161 1/1   lasmic binding protein-like II          
   1::614


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLFVLFLAVLSVLVLAEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIAYKGESLTEFE
00502991   1/1  ------------------dakkggtLrialtgdpdtldpalatgaasa.vlrliyegLvrydpedg.elv
00475671   1/1  ---------------hldyanpaaakggtlrialsgdpdtldpalatgaasaavlrliyegLvrydpd..
00463781   1/1  -----------------------gtLrialtgdpdtldpalatgsasallllrliyegLvrydpedg.el
00510461   1/1  ------------------dakkggtLrialtgdpdtldpalatgaasalvlrliyegLvrydedg..elv
00444861   1/1  ---------------------kggtLrvalsgdpdtldpalatgaasaavlrliyegLvryde.dg.elv
00499161   1/1  -----------------------gtLrvaltgepdtldpalatgaasa.llrlvyegLvrydedg..elv


                         -         -         *         -         -         -         -:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
00502991   1/1  pllAeswevsddg.tytfkLRpgvkfsDGtpltAeDvvfslerlldpd..aspyasllslik........
00475671   1/1  gelvpllAeswe.seDgltytFkLRpgvkfsDGtpvtAeDvvfslerlldpgtasplayallllli....
00463781   1/1  vpllAeswevsddgltytfkLRpgvkfsDGtpltptreltAeDvvfsler..lldpgtaspya....ikg
00510461   1/1  pllAeswevsddgltytFkLRpgvkfsDGtpltAeDvvfslerll..dpdtaspyasllanik.......
00444861   1/1  palAeswevsddgltytfkLRkgvkfsDGtpltAeDvvfslerll..dpktaspyasllalik.......
00499161   1/1  pllAeswevsddgltytFkLRkgvkfsdGtpltaeDvvfsler..lldpgtaspyasllslik.......


                         +         -         -         -         -         *         -:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
00502991   1/1  .....................................gveavddytvritlkkpnplfllllalp...lp
00475671   1/1  ........................knalailagglladiegveavddytveitlkkpdplflllla..sp
00463781   1/1  adey............................ldgkalldliegveavddytveitlkkpdplfllllal
00510461   1/1  ......................................gveavddytvvitlkkpdplfllllalp...l
00444861   1/1  ......................................gveavddytveitlkkpdplfllllasp..al
00499161   1/1  .....................................gveavddytveitlkkpdplfllllalpa.lla


                         -         -         -         +         -         -         -:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
00502991   1/1  ilpkhalekvgddfgtd..............llaenpvgtGPYklkewdpgq..ivlernpdYwgkdlpv
00475671   1/1  alailpkhalekl.................gddltlaenpvgtGPyklkewd.pgerivlernpdYwgkk
00463781   1/1  p..alailpkhaleklgddfgtd..............llaenpvgtGPyklkewd.pgqrivlernpdYw
00510461   1/1  ailpkhalekvgddl............llglatlaenpvgtGPyklkewd.pgqrivlernpdYwggkpk
00444861   1/1  ailpkhalekv...................gddfaenpvgtGPyklkswk.pgqrivlernpdYwgkgkp
00499161   1/1  ilpkhaleklgadfl.aen.................pvgtGPyklkewe.pgqrivlernpdYwggkpkl


                         -         *         -         -         -         -         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
00502991   1/1  gkpkldrivfrvipdasarlaallsGevDvaelppddlatlkknpglkvvklllpnvpslgtyylafNtr
00475671   1/1  lpkldrivfrvipdasarlaallsGevDvallvppddlalllkdlpglevvsvpglgtyylafNtrkp..
00463781   1/1  ggkpkldrivfrvipdasarlaallsGevDvalelppddlatlkkdpglk.vvsvpslgtyylafNtrkp
00510461   1/1  ldrivfrvipdastrlaalksGevDvaelppddlatlkkdpglkvvsv.pslgtyylafNtrkp......
00444861   1/1  kldrivfrvipdastrlaallsGevDvalelppddlallkkdpglkvvs.vpslgtyylafNtkkp....
00499161   1/1  drivfrvipdasarlaallsGevDvalellswlppddlealkknpglevvs.vpglgtyylafNtr....


                         -         -         -         -         *         -         -:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDLPEGLLGFNEELLNDPDAPHFDIV
00502991   1/1  kp...................pfddvrvRqAlalaidreaivdavlgglgtpanslfsnllppglpgydp
00475671   1/1  .................pfddvrvRqAlalaidreaivdavlgglgtpansllppglpgyddlpaeaelk
00463781   1/1  ...................pfddvrvRqAlalaidreaivdavlgglgtpansllppglpgydddl....
00510461   1/1  .............pfddvrvRqAlalaidreaivdavlgglgtpansllppglpgynddll..lppyeyd
00444861   1/1  ...............pfddvrvRqAlalaidreaivkavlgglgtpansllppglpgynd.....lppye
00499161   1/1  ...............kppfddvrvRqAlalaidreaivdavlgglgtpansllppglpgynddl....pp


                         -         -         +         -         -         -         -:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
00502991   1/1  dlpg.llpyeydpekAkalLaea....GytkkdgdgirelpdGkpleltlltpsgnperkaiaeaiqqql
00475671   1/1  pyeydpekAkalLaeaGy..pdgkpltltllltsdspelkriaeaiqqqlkkiG..ikvelrvvdwatyl
00463781   1/1  kpyeydpekAkalLaeaGy....pdgkpltltlltvsrsdnpelkaiaeaiqqqlkkiG..ikvelrvvd
00510461   1/1  pekAkalLaea....GykdlggdgirekdgkpleltlltpsgnpelkaiaeaiqqqlkkiG..ikvelrv
00444861   1/1  ydpekAkklLaeagy....pdgkpltltlltdsptakaiaeaiqqqlkkiG..ikvelrvvdwatyldrl
00499161   1/1  yeydpekAkalLaeaGyklldgdgirepdGkpltltlltpsgspalkriaeaiqqqlkklG..ikvelrv


                         *         -         -         -         -         +         -:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGGRSLDELIEEAIAKTDPAERQ
00502991   1/1  kkiG..ikvelrvvdwatyldrlrsgdfdlallgwglgdypdpdnflsllyssdaadlgllggsnlsgys
00475671   1/1  drlragdfdlallgwgadypdpdsflllllsg...............ggsnlsgysnpeldalleealae
00463781   1/1  watyldrlragdfdlallgwgadypdpdnflsllygsdaa...ggglnlsgysnp........eldalld
00510461   1/1  vdwatyldrlraggpdfdlallgwgladypdpdnflslllss.......gglnlsgysnp........el
00444861   1/1  llkdprsgdfdlallgwgadypdpdnflsllysssaad..ggslnlsgysnp........eldalldeal
00499161   1/1  vdwatyldrlrngdfdlallglwgady.dpdnflsllfgsdaad...gglnlsgysnpe........lda


                         -         -         -         *         -         -         -:630
query           ALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPMRPGDDYYVLWKAEE----------------
00502991   1/1  np.......eldalleealaatdpeerkelyreaqrilledapviplyylp-------------------
00475671   1/1  tdpeerkalyaeaqrilaedapviplyhlvlvvavsknvkgvvlnplgyldflk----------------
00463781   1/1  ealaetdpeeraelyaeaqrilledapviplyylvlvvavskrvkgvvlnp-------------------
00510461   1/1  dalldealaetdpeerkelyreaqrilledapviplyylvllvavskrvkgvv-----------------
00444861   1/1  aatdpeeraalykeaqkilledapviplyylvllvavnkkvkgvvlnplgl-------------------
00499161   1/1  lleealaetdpeerkalyreaqrilaedapviplyhlvlllavskrvkgvp-------------------