[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35671.1


[Show Plain Result]

## Summary of Sequence Search
   1::301
  37::138  4.6e-09 23.5% 0043518 00435181 1/2   drug resistance efflux transporter EmrE 
 174::282  9.3e-09 25.7% 0043518 00435182 2/2   drug resistance efflux transporter EmrE 
   1::301


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MILERFFAWLVVVFWGISFLATKVVVQVLDPFFAGFLRFIFAFFFLFLISGGRPKLFNKNIVMAGFWGVF
00435181   1/2  ------------------------------------lrlllaallllpfalllklspgrtwllllllgll
00435182   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SYFAFENSALMFTEPTNAAIIVSSAPVFFLLFSHLVQKKKTTSKMYLGVILSFLGVALVVLNGRFVLKLN
00435181   1/2  ltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsllqllGialilaGvlllllggr--
00435182   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PLGDLLAFGAALSWVFYTHHIESLGSLSFRENAGIMFWGVVFFLPFSAGKFQQIREMNSIVVISLLYLGL
00435181   1/2  ----------------------------------------------------------------------
00435182   2/2  ---------------------------------lrlllaallllpfalllkls....pgrtwllllllgl


                         -         -         -         +         -         -         -:280
query           VCSGLAYFLWNKAIERLGSRTTTNMIYYIPVVTAVAEHLLKLKLPSALLVGGVVLVVIGLLIFEREVHYE
00435181   1/2  ----------------------------------------------------------------------
00435182   2/2  lltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsllqllGialilaGvlllllggrr


                         -         *         -         -         -         -         +:350
query           TEDSTRGMRKDRTEETRPSAD-------------------------------------------------
00435181   1/2  ----------------------------------------------------------------------
00435182   2/2  rk--------------------------------------------------------------------