[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35678.1


[Show Plain Result]

## Summary of Sequence Search
   1::246
   1::246  7.4e-77 52.2% 0051706 00517061 1/1   lasmic binding protein-like II          
  24::245    3e-73 50.0% 0052589 00525891 1/1   lasmic binding protein-like II          
  26::244  6.5e-72 51.9% 0049318 00493181 1/1   lasmic binding protein-like II          
  25::244  1.1e-69 50.2% 0040650 00406501 1/1   lasmic binding protein-like II          
  19::247  1.5e-69 43.2% 0051099 00510991 1/1   lasmic binding protein-like II          
  25::244  3.5e-68 47.0% 0038704 00387041 1/1   lasmic binding protein-like II          
   1::246  8.2e-68 46.5% 0048727 00487271 1/1   lasmic binding protein-like II          
  26::245  5.2e-66 46.3% 0047371 00473711 1/1   lasmic binding protein-like II          
  29::244  6.6e-64 48.6% 0050446 00504461 1/1   lasmic binding protein-like II          
  28::246  3.5e-60 43.6% 0046857 00468571 1/1   lasmic binding protein-like II          
  26::245    1e-17 26.2% 0051090 00510901 1/1   lasmic binding protein-like II          
  35::233  1.6e-17 21.5% 0049987 00499871 1/1   lasmic binding protein-like II          
  53::232  8.6e-06 20.1% 0052509 00525091 1/1   lasmic binding protein-like II          
  46::199  0.00039 20.1% 0043543 00435431 1/1   lasmic binding protein-like II          
  29::146  0.00074 23.2% 0042201 00422011 1/1   lasmic binding protein-like II          
   1::246


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLLAVSILLVSIVIFSGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
00517061   1/1  MkkllllllllllllalaaaadtlekikeggtlrvgtdadypPfefvdedgklvGfdidlakaiakrlgv
00525891   1/1  -----------------------IkergtlrvgtdadypPfvfvdledgklvGfdidlakalakrlgvkv
00493181   1/1  -------------------------eggtLrvgt.adypPfefvdltddlltengklvGfdidlakalak
00406501   1/1  ------------------------kergtLrvgtdpdypPfsyldedgelvGfdvdlakaiakrlgvkve
00510991   1/1  ------------------LlslaaiaaagtlrvgvspdypPfsyldedgkltGfdvdlakalakrllgdp
00387041   1/1  ------------------------kergtlrvgvdpdypPfsyldedgklvGfdvdlakalakrlgvkve
00487271   1/1  Mk...........................Lrvgt.pdypPfsyldevlsdGkllellllndellkallll
00473711   1/1  -------------------------gsagtLrvgt.pdypPfsyl.edgenllltGfdvdllkaiakrlg
00504461   1/1  ----------------------------tLrvgvdpdypPfsfld.dgklvGfdvdlakaiakrlglkve
00468571   1/1  ---------------------------gtlrvgvdlslpyvmllepfsyldgngkltGfdvdllralakr
00510901   1/1  -------------------------ekktlrigylpgpdaapl............elakglfkklGldve
00499871   1/1  ----------------------------------ppktlrigtgspggtyyplgvalakglfkellglkv
00525091   1/1  ----------------------------------------------------Fdpaessgtfrigvsdsl
00435431   1/1  ---------------------------------------------aagtLtvysasgltdalkelakaFe
00422011   1/1  ----------------------------tikvgatpphaei.............levikkllkkkGidve


                         -         -         *         -         -         -         -:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
00517061   1/1  kvefvpvddgkyglllngswdglipalqsgkvDlaiagltitpeRkkvvdFsdpyyesglvilvrkdski
00525891   1/1  efvlvedgkygllldngswdglipalqsgkaDlaiagltitpeRekvvdFsdpyytsglvllvrkgsplp
00493181   1/1  rlgvkvefvlvedgkygllldlngswdglipaLqsgkaDlaiagltitpeRekvvdFsdpyytsglvilv
00406501   1/1  fvpvdwdrllpalqsgkvDliiagltitperekvvdfsdpyytsglvlvvrkdspl.iksledLkgkrvg
00510991   1/1  vkvefvpvpwdrllealasgkvDlaiagltitperekgvdfsdpyytsglvlvvrkdsp..iksladLkg
00387041   1/1  fvpvswdgllpalasgkvDlaiagltitperakvvdfsapyyvsglvlvvrkdspl.iksladLkgkrvg
00487271   1/1  gsndllllllklllpekltGfdvdllkalakrlgvkvefvlvedglyGslldlllslplpwdrllpalqs
00473711   1/1  vkvefvpvlpwdrllpalqsgkvDlliagltitperekvkkvdfsdpyytsglvlvvrkdspldikslad
00504461   1/1  fvpvdwdgllpalqsgkvDlaiagltitperekvvdfsdpyyssglvlvvrkdns.giksledLkgkrvg
00468571   1/1  lglkvelvpvpdglygglnlengswdgllgalqsGeaDlaaggltitperekvvdfsapylesglvllvr
00510901   1/1  lveftdgaallealasGelDvalfgslpyllayakglpvklvavlstygsalvvr.dsgik..slaDLkd
00499871   1/1  evvptggsvanlealaaGevDlalvgsdpallaqagtgpfegkgapldnlravaalypeplalvvrkdsg
00525091   1/1  altllppllarlrkeaPgvrlelvelpsdelleaLregelDlaiaylpigplrdpglvs.eplfeeplvl
00435431   1/1  kkykeetgtgikveyvyggsgallakllagaqaDvvasadagdldrlakagllqpldpkklpyavplatg
00422011   1/1  ivefsdysapneaLasGeiDanafqhlpyldafnkenaglklvavgaty.iaplglyskk.....iksle


                         +         -         -         -         -         *         -:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
00517061   1/1  ksslfaflkplddlkgkkvgvqkgttaeeylkkllkkmlpgaklvlyddldeallaLksGrvdafvldsp
00525891   1/1  iksledlkgkkvgvqrgsttedylkkllkelykllyelmvpgaklvlydsleealqaLlsg.vdavvgds
00493181   1/1  rkdsdppiksledlkgkkvgvqkgstaedylkklleplykkllklklpgaklvlydsleealeallsgr.
00406501   1/1  vvkgttyelllkkllkkpglkivlvddlaealqaLlaGrvDaavadspvlayllkklpllglllllglvv
00510991   1/1  krvgvvrgssyeelllellpdvklvevdspeealaaLaaGrvDaavtdepvlayllkqlpdlkvgvgepl
00387041   1/1  vvkgstyelllkkllkkpglkivdyddpaealaaLaaGrvDaavadepvlayllkkgpllalavtsdlrv
00487271   1/1  GkvDlaiagltitpeRekvvdfsdpyytsglvlvvrkd..spiksledllLlklkgkrvvgvvrgssyee
00473711   1/1  lkgkrvgvvrgstyeellk.lpgaklvevdsleealeaLlagrvdavvadlpvlayllkqlplldlkvvg
00504461   1/1  vvrgssteellkkllpdaklvlvdsleealaallsgrvdavvadspvlayllkklplddlkvvgeplsse
00468571   1/1  kdspllspiksledLkgkdglkvgvvrgssteeyllelllelglllldkmipdvkvvevdspeealeala
00510901   1/1  GkkvavpnggstsglllallkkaGlikldplkdvklvnld.padavaalasgevDaavlweplddvdlav
00499871   1/1  ik..slaDLkGKrvavgapGsgtellllalleaaGltpddvelvvnlgpadaaaaladgkvDAavtvdpl
00525091   1/1  vaspdhplaggeltledlagyplilvspgsglrrlldealaeaglkprialevdsleallalvaagdgia
00435431   1/1  tlvlivnkdnpkkikswddLlkpgvkvvlpdpktsgtgrlallallaaglskdkgdeek-----------
00422011   1/1  dLkdgk----------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE----------------------------------
00517061   1/1  vlayllkknpgadlkvvgellplttegygiavrkgs----------------------------------
00525891   1/1  pvllyllkknpdlkvvgeplstegygiavrkgsp.-----------------------------------
00493181   1/1  dafvadspvlayllkknpdlkvvgeplltegygi------------------------------------
00406501   1/1  lgeplspeplgiavrkgdpellaalnkalaelka------------------------------------
00510991   1/1  sseplgiavrkgdpelldalnkalaalkadgeldkil---------------------------------
00387041   1/1  lglplspeplgiavrkgdpellealnkalaklka------------------------------------
00487271   1/1  ylkellpgaklveyiklvvvdsleealaalasGrvD----------------------------------
00473711   1/1  eplsseplgiavrkgdp.lldalnkalaalkedGe-----------------------------------
00504461   1/1  plgiavrkgdpelldalnkalaelkedgeldkil------------------------------------
00468571   1/1  sGrvdyafvvdspvlayllkklpcdlrivgelllse----------------------------------
00510901   1/1  inanaaleaglrvladsldieggpslyvnvlvvrk-----------------------------------
00499871   1/1  laaaiaelaaggglrllpldddl-----------------------------------------------
00525091   1/1  llprslaeellaagdlvvlplp------------------------------------------------
00435431   1/1  ----------------------------------------------------------------------
00422011   1/1  ----------------------------------------------------------------------