[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35750.1


[Show Plain Result]

## Summary of Sequence Search
   1::377
  11::377 1.4e-102 41.7% 0045909 00459091 1/1   ependent transferases                   
   5::378  1.3e-96 40.6% 0052731 00527311 1/1   ependent transferases                   
   3::378  1.7e-89 36.7% 0040897 00408971 1/1   ependent transferases                   
  16::378  4.3e-81 36.3% 0041704 00417041 1/1   ependent transferases                   
  16::374  8.9e-73 32.6% 0052302 00523021 1/1   ependent transferases                   
  15::377    1e-67 30.8% 0045973 00459731 1/1   ependent transferases                   
   4::377    3e-67 31.3% 0044083 00440831 1/1   ependent transferases                   
  13::377  1.7e-64 33.9% 0046087 00460871 1/1   ependent transferases                   
   3::379  1.3e-56 27.7% 0046154 00461541 1/1   ependent transferases                   
  39::377  1.4e-55 31.3% 0048747 00487471 1/1   ependent transferases                   
   1::377  1.8e-53 28.3% 0040134 00401341 1/1   ependent transferases                   
  32::376  2.7e-50 27.4% 0048952 00489521 1/1   ependent transferases                   
  26::373  3.6e-49 23.0% 0049524 00495241 1/1   ependent transferases                   
  17::373  2.2e-45 27.1% 0038034 00380341 1/1   ependent transferases                   
  13::377  1.4e-44 24.9% 0046165 00461651 1/1   ependent transferases                   
  17::377  4.4e-44 29.3% 0039341 00393411 1/1   ependent transferases                   
  10::333  2.1e-43 26.6% 0053335 00533351 1/1   ependent transferases                   
  14::377  1.7e-41 27.6% 0046747 00467471 1/1   ependent transferases                   
  10::377  1.8e-41 25.3% 0046007 00460071 1/1   ependent transferases                   
  16::378  2.8e-41 26.2% 0051195 00511951 1/1   ependent transferases                   
  16::377  2.9e-41 26.6% 0044595 00445951 1/1   ependent transferases                   
   1::377  7.7e-40 29.5% 0035589 00355891 1/1   ependent transferases                   
  29::377  2.3e-37 26.3% 0036406 00364061 1/1   ependent transferases                   
  11::376  2.7e-37 27.9% 0049754 00497541 1/1   ependent transferases                   
   1::377  7.5e-37 27.6% 0041674 00416741 1/1   ependent transferases                   
  16::377  8.6e-36 28.1% 0046965 00469651 1/1   ependent transferases                   
  37::378  2.2e-34 26.2% 0044807 00448071 1/1   ependent transferases                   
   2::333  2.9e-34 27.2% 0050261 00502611 1/1   ependent transferases                   
  16::378  3.2e-34 27.3% 0036780 00367801 1/1   ependent transferases                   
  11::378  6.5e-34 25.2% 0050157 00501571 1/1   ependent transferases                   
  16::377  1.1e-33 28.5% 0050696 00506961 1/1   ependent transferases                   
  35::377  7.9e-33 25.6% 0049070 00490701 1/1   ependent transferases                   
  12::377  1.3e-32 26.2% 0050390 00503901 1/1   ependent transferases                   
  15::378  1.4e-31 27.2% 0041260 00412601 1/1   ependent transferases                   
   6::377    7e-31 25.1% 0042144 00421441 1/1   ependent transferases                   
  26::279  2.2e-30 25.7% 0035246 00352461 1/1   ependent transferases                   
  35::378  2.6e-30 25.0% 0047340 00473401 1/1   ependent transferases                   
  35::377  1.5e-29 23.5% 0052070 00520701 1/1   ependent transferases                   
  34::377  4.5e-29 24.0% 0048074 00480741 1/1   ependent transferases                   
   3::376  4.8e-28 22.8% 0049486 00494861 1/1   ependent transferases                   
  37::377  2.4e-27 24.0% 0046056 00460561 1/1   ependent transferases                   
  14::377  2.6e-27 23.8% 0050754 00507541 1/1   ependent transferases                   
   6::376  1.8e-25 21.0% 0046584 00465841 1/1   ependent transferases                   
  38::316  1.1e-22 24.0% 0052862 00528621 1/1   ependent transferases                   
   8::333  8.5e-21 22.1% 0046547 00465471 1/1   ependent transferases                   
  37::377    1e-20 20.8% 0047441 00474411 1/1   ependent transferases                   
  12::333  4.9e-20 27.0% 0050768 00507681 1/1   ependent transferases                   
  17::377  5.2e-19 27.4% 0048571 00485711 1/1   ependent transferases                   
   6::316  1.1e-18 25.5% 0051757 00517571 1/1   ependent transferases                   
  16::377  1.3e-18 20.3% 0035846 00358461 1/1   ependent transferases                   
  35::377  2.4e-18 24.7% 0050753 00507531 1/1   ependent transferases                   
   8::279  5.1e-18 24.4% 0037039 00370391 1/1   ependent transferases                   
  30::377  5.3e-18 23.4% 0050076 00500761 1/1   ependent transferases                   
  37::279  6.5e-18 29.2% 0046024 00460241 1/1   ependent transferases                   
   8::166  1.9e-17 31.2% 0047095 00470951 1/1   ependent transferases                   
  37::313  2.7e-16 23.8% 0046206 00462061 1/1   ependent transferases                   
  36::279  5.9e-16 28.3% 0037569 00375691 1/1   ependent transferases                   
   1::279  8.8e-16 24.9% 0035401 00354011 1/1   ependent transferases                   
   2::161    1e-15 29.1% 0038952 00389521 1/1   ependent transferases                   
   8::166  3.4e-15 28.6% 0052164 00521641 1/1   ependent transferases                   
  20::315  2.4e-14 21.8% 0042383 00423831 1/1   ependent transferases                   
  37::333  3.8e-14 20.8% 0047670 00476701 1/1   ependent transferases                   
   4::330  1.1e-13 24.2% 0051723 00517231 1/1   ependent transferases                   
  11::279  1.3e-13 25.2% 0051323 00513231 1/1   ependent transferases                   
  37::308  3.3e-12 23.9% 0045171 00451711 1/1   ependent transferases                   
  11::313  8.4e-12 23.6% 0045392 00453921 1/1   ependent transferases                   
  11::161  9.5e-12 30.9% 0050977 00509771 1/1   ependent transferases                   
   1::159  1.5e-11 28.5% 0046089 00460891 1/1   ependent transferases                   
   1::282  1.8e-10 22.1% 0047581 00475811 1/1   ependent transferases                   
  11::316  5.2e-10 24.9% 0042809 00428091 1/1   ependent transferases                   
   1::161  1.2e-09 26.1% 0047956 00479561 1/1   ependent transferases                   
  40::161  6.9e-09 33.1% 0042806 00428061 1/1   ependent transferases                   
  40::157  1.6e-08 35.3% 0040526 00405261 1/1   ependent transferases                   
  26::377  1.1e-07 22.2% 0035700 00357001 1/1   ependent transferases                   
  52::161  7.7e-07 29.4% 0045639 00456391 1/1   ependent transferases                   
  36::157  1.2e-06 31.4% 0046255 00462551 1/1   ependent transferases                   
  12::163  1.7e-06 26.2% 0052157 00521571 1/1   ependent transferases                   
  12::160  2.6e-06 24.0% 0052943 00529431 1/1   ependent transferases                   
   8::166  4.1e-06 26.1% 0051993 00519931 1/1   ependent transferases                   
  57::159  4.5e-06 28.2% 0045231 00452311 1/1   ependent transferases                   
  56::159  6.2e-06 28.2% 0045068 00450681 1/1   ependent transferases                   
  18::159  8.8e-06 28.7% 0044523 00445231 1/1   ependent transferases                   
  12::161    1e-05 25.0% 0051601 00516011 1/1   ependent transferases                   
  37::206  4.6e-05 25.2% 0035586 00355861 1/1   ependent transferases                   
  57::129  4.6e-05 34.7% 0035073 00350731 1/1   ependent transferases                   
  17::377  7.6e-05 20.4% 0050340 00503401 1/1   ependent transferases                   
   1::377


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
00459091   1/1  ----------ksdliPdfptipeeeieavaealdsgilsytlgpgvkelEeaiaellgakyalavssGta
00527311   1/1  ----kkiplgspvfdeeeiaavlealdsgvytlgptvdelEealaallgakyavavssGtaAlllallal
00408971   1/1  --iplplgepdf..peevleaviealdsggytrgpgvaeleealaellgaehavatnsgtaAlllallal
00417041   1/1  ---------------PevlealaevlesgwlygtgpgveeleealaellgaeeavftssgteAlnlalla
00523021   1/1  ---------------mkfetlllhagldpdpltgavnppiylsstpvfdtpeeiaaaf.ealesgyiysr
00459731   1/1  --------------dkllsellelllaagllrldpeifsalrkelkrgkdlinliasnnylppavleall
00440831   1/1  ---lgslpepevgaqgepieliageeyldalvgaglinlghghpdvvidLlsdtltgpvltaqlaellpg
00460871   1/1  ------------lklllepfrikvvepidptiaeeiekelkraggnlfllasenvyidlvsdaltgsplp
00461541   1/1  --lselllllleglyevdpeiaeliekelkrqgevllliasenylspavlealgsaltnkyaegypgsry
00487471   1/1  --------------------------------------deleealaellgaeealvtssgteAlelalla
00401341   1/1  miplgsetrklldlisndylglaeiyllyasetpvppevlealleallnkygegnpgsryyggtlyvdpl
00489521   1/1  -------------------------------mdlsklldrletlalhagllpdvllatgadviplgqgep
00495241   1/1  -------------------------lldlldirllfpalslfalgkdliyldnaattplppevleamlea
00380341   1/1  ----------------llalgtdvihlgsgepdylgpvappiylsstftfevleaviealagggtgydys
00461651   1/1  ------------kldtllvhagrlldlgtggidliilstgeppfpvpeavlealaealasghlygygpgp
00393411   1/1  ----------------avlealaealesgllgygpspglpelrealaellgarygvavdpeeivvtnggt
00533351   1/1  ---------lfkrlgrlppspirgllalladldgkdvidlgvgiyldpepdlppppavlealaealddga
00467471   1/1  -------------lllllllllllldeelllllaeelyrlplvivrgegarlldvdgreyidlasnnylg
00460071   1/1  ---------dlldlldelleelkpeglyrplpivkgegarlidvdgreyldlssndylgghthpevveaa
00511951   1/1  ---------------llkrllkldtlairagfpllartggvivldlsagtppfpvpeavlealaealagg
00445951   1/1  ---------------lelssrldglpaslirellelaggpdvidlgvgepdlpppeavlealaealggll
00355891   1/1  Msllssrllglkpslvleilelaalldadgkdvidlgagepdlppppavlealaealdsgllgygpppgl
00364061   1/1  ----------------------------gtlsvdpleeeleerlaelfgaeaailltnsGtaAnlaalla
00497541   1/1  ----------nmllserldrlppsailelleladgpdvidlgsgepdlppppavlealaealdngllgyp
00416741   1/1  issrllnlppyvfdeilelaalldadgpdvidlgvgepdlppppavlealaealesgllrygdptglpel
00469651   1/1  ---------------llskrlerlppspilellellaggpdvidlgvgepdlppppavlealaealdsgl
00448071   1/1  ------------------------------------leelrealaellgadpayevvftsggtealeaal
00502611   1/1  -lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepdlglgp.ppavlealaealae
00367801   1/1  ---------------kdlsletlaihagsgpdvlnlvgppiyltnefvfelpeavlealaegltgytysr
00501571   1/1  ----------leellelleslllsllyrlplvivraegayltdvdgrryldlssglpvnplGhsppevle
00506961   1/1  ---------------pgsgtfvsdrlpdlppspirellelaggpdvidlgigepdlgppplpaviealae
00490701   1/1  ----------------------------------elveelrerlaellgadpaeivftssgtaalnaall
00503901   1/1  -----------mllserldrlgpsvidellelaggpdvidlgigepdlppppevlealaealdsgalllr
00412601   1/1  --------------ealellalgtdvihlgsnenplgavappiyqtptfvldalaealdggrygrgpnpg
00421441   1/1  -----kgviyldsaattpvppevlealaealeslllfgnphslghelsrgatplleelrellaellgadp
00352461   1/1  -------------------------rkfiaeplriksaegvyltdvdgreyldalsgynvlllghgdpei
00473401   1/1  ----------------------------------ptleeleealaellgaeealltsggtaailaal.al
00520701   1/1  ----------------------------------elleeleealaellgaeevlltssGteAneaallal
00480741   1/1  ---------------------------------iyldnagptplppavlealleglghrsgygytellee
00494861   1/1  --liyldsdattppppavlealaealevgdgnygsdpgleelrealaellgaeaaeivftsgGteAnlla
00460561   1/1  ------------------------------------leelrerlaellgadspdevvftsggtealnlal
00507541   1/1  -------------ryippteeeiaemldaigvssldelfdpipleirrgeglplpdlserevldelsgla
00465841   1/1  -----efpllkgliyLdnaalgllppavleamaealeelagngssghrlsrgatelveelreklaellga
00528621   1/1  -------------------------------------ladrlknlppsitlallalalellaggkdvidl
00465471   1/1  -------dliyldnaaptplppevleamaealeklygnpssghelgygatelleelrealaellgadpde
00474411   1/1  ------------------------------------leelrealaellgadpdvvlltgggtealeaall
00507681   1/1  -----------llldlslllsdrllglppsvirkllelaagpdvidlgigepdlppppleavrealaeal
00485711   1/1  ----------------lelslpllltelpglsselllelllslllslyaplplvivraegaylydvdGnr
00517571   1/1  -----elirketlrlrggin.asenvlslnvlgaqtspevieaaeealggygysrggdplreeleellae
00358461   1/1  ---------------pplfdalvklaeegpysfhvpghkggvlnfasnlylgfpdfpgpnealealgaal
00507531   1/1  ----------------------------------elleelqerlaellgadaanvvltdggtaaleaall
00370391   1/1  -------lavlnirllilvsllllkpllevdpeiaeiiekeldrqregleliaseNylslavlealgsvl
00500761   1/1  -----------------------------gtehidflsdnptgphpavlealaeallgddlgygadplve
00460241   1/1  ------------------------------------lpelreaiaellgrrygvdvdpallkledeivvt
00470951   1/1  -------llllllfpllllfpllkgliyLdnagptplppevleamleal...ihhlgpeftelveearel
00462061   1/1  ------------------------------------rqvggivlilsenappfyvpeavldalteayaeg
00375691   1/1  -----------------------------------glpelreaiaellgvdpeeilvtnGatealalllr
00354011   1/1  Mssflklllssrlkslkpsvilellelaaelgangpdvidlgvgepdfgpplldllgltlplpavleala
00389521   1/1  -mssflstllsprlkslkpyvigellelaaelgaggpdvidlgigepdlgtpplelllltlvlpavleal
00521641   1/1  -------lrllfpirelfpllmdliyldnagptplppevleamleal...ishrspeftelveearella
00423831   1/1  -------------------llkivdllnekvldvlgsevldellpkyelPeeglsleevlellkdllsld
00476701   1/1  ------------------------------------eeevadwlaellglpvaflllgadpaggvftsGg
00517231   1/1  ---llllleslaevdpeildliekelkrqrevleLiAseNylspavlealgsvltnkyaegypgkryygG
00513231   1/1  ----------klllskrldrlgpspirallllaagpdvidlgigepdfppppavlealaealdeggalll
00451711   1/1  ------------------------------------lpelreaiaellarygvgvdpeevvvtnGgteal
00453921   1/1  ----------ptprskellerakklllggytslplvivraegaylydvdgnrylDflsgigvlnlGhnhp
00509771   1/1  ----------smdlserlsrlpsyireilelaaelgadgkdvidlgvgepdlldfppppavlealaeald
00460891   1/1  mmllsdrlldlkpsvilkllalaaelgaggpdvidlgigepdfppppavlealaealdegllgYppglpe
00475811   1/1  midlrsdtvtpptpevleamaea...nvgddvygedptvneleerlaellgkeaavfvpsGtmanllala
00428091   1/1  ----------mpkslelldraklllpggvnsyvrlplvieraegaylydvdgnrylDflsgigvlnlGhn
00479561   1/1  llppspilsllelaaelgaggkdvidlsvgepdfppppavlealaealdgllrypdpglpelreaiaall
00428061   1/1  ---------------------------------------lreaiaelllrrygvgldpervaivvtnGgt
00405261   1/1  ---------------------------------------LreaiaallggvyglavdpenivvtaGatea
00357001   1/1  -------------------------ishrskefteileearellaellgapddyevvlltgggtaaleaa
00456391   1/1  ---------------------------------------------------qtlsttGatealalllral
00462551   1/1  -----------------------------------vidlsvgepdfppppavlealaealdgllgyypsa
00521571   1/1  -----------pevvealkeqldklghvs..gttelavelaekLaellpglekvfftnsGseAneaalkl
00529431   1/1  -----------pevvealkeqldrlghvs..gttepavelaelLaellpglekvfftnsGseAneaalkl
00519931   1/1  -------kpliyLdgpgptplpprvleamaryl...ihhrspeftelleearellaellgakndlkytei
00452311   1/1  --------------------------------------------------------nGatealslalral
00450681   1/1  -------------------------------------------------------tnGatealllaarfl
00445231   1/1  -----------------llellaaellaggpdvidlsvgepdfppppavlealaealddgvlgyypdpgl
00516011   1/1  -----------msskelipgdlnsllrpftglldplvivraegaylydvdGneylDflsglgvlnlGhsh
00355861   1/1  ------------------------------------leearallrellgapedyevlflsGggtaafeaa
00350731   1/1  --------------------------------------------------------nGgtealslaaefl
00503401   1/1  ----------------mplvylfsaGPaalppevlealaeellnyngvgrsvlelshrskefteileear


                         -         -         *         -         -         -         -:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
00459091   1/1  AlllallalglgpgdeVivpsptfvatanaillagakpvfvdvdpdtfnidpedleaai.tpktkaiipv
00527311   1/1  lglgp.dgkeVivpsltfvatanaillagakpvfvdvdpdt.nidpedleaaitp.ktkaiipvnllGqv
00408971   1/1  glgpGDeVivpaltfvstanavllaGakpvfvdvdpdtfnidpealeaai.tprtkaivpvnptGavadl
00417041   1/1  lglgpgdevivpspthvatlaailllGakpvfvdvde.tgnidlealeaaieehtpktkaiivvnptGvv
00523021   1/1  iggptveeleealaellgaeealltssgtaAlllallal.lkpGDevivpaptygstaeairlllkrlGa
00459731   1/1  ealtnkygegypgsrlylgteavgplveeleerlaelfgaeadelgvavftssGtaAlllallal.lkpg
00440831   1/1  dryyggnpgvdeLeerlaellgaehavftnsGteAnllalkal.lkpgdevivpdlayggtteagllaga
00460871   1/1  amyaal..evgddyygggptvdeleervaelfgaehavfthsGtaAnllallal.lkpGdevivpdhfla
00461541   1/1  yggteyvdpleeeleerlaelfgaehallfanvqpssGtaAnlaallal.lkpgdevltpslehgGhlth
00487471   1/1  l.lkpGDevivpsptygatleairll.akpvfvdvdedggn.dlealeaaitp.ktkaiilehpsnptGt
00401341   1/1  veeleerlaelfgaeaalvftnsGtaAnlaallal.lkpgdevlvpslahgstlaaarlagakrlgievv
00489521   1/1  dvppaveealallgagatgygysrgtgplrealeerlaellgaeevlltsggteAlelallal.lkpGde
00495241   1/1  llellgnphssgyslsrganplveelrerlakllgaddpeeivftsggtealnlallalalaglkpGdev
00380341   1/1  rgpnptvealeealaellgaeaalvtssgtaAillallal.lgpGDevlvpdplygstielfglalrlaG
00461651   1/1  gveelrealaellgaeevlltsggtealelallal.lkpGdevlvpdptypsylaaarll.aevvfvpld
00393411   1/1  ealllallal.lgpGdevlvpdptypaylaalrlaGaevvfvpldpdggflldpealeaai.tpktklvl
00533351   1/1  gllgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealelalralrklgpgdevivpspty
00467471   1/1  lghhpavleaaiealdkygvgspgsrllygttplhdeleerlaellgaeaalvfnsGteAnlaalral.l
00460071   1/1  aealdklglgsggsrllygtnplheeleealaellgaeaallfnsGteAnlaalkal.lgpgdivivdel
00511951   1/1  rygyggnpgveeleealaellgaeealvtsggtaaillallal.lkpGDevlvpapaygsylallrlllk
00445951   1/1  gypdppglpelreaiaallgvdpeeivvtsGatealnlalral.lgpGdevlvpsptypaylaalrllGa
00355891   1/1  pelrealaellgarygvavdpeeivvtnggtealelalral.lgpGdevivpsptypgylaaarllGaev
00364061   1/1  l.lkpgdevlvddlahgstlagarlanasglGaevvfvpvd.edglidledleaal.kektklivlessn
00497541   1/1  psqglpelrealaellaellgadldpetevlltsggtealelalral.lgpgdevlvpdptypgylaaar
00416741   1/1  reaiaellgrrrgvavdpeevvvtnggtealelalral.lgpGdevlvpsptypgylaaarlaGaevvfv
00469651   1/1  lgygppaglpelreaiaeyllrrrgvgvdpeteilvtnGatealalalral.lgpGdevlvpsptypaya
00448071   1/1  lal.lkpgdevlvsapghpsvllaeaaerlGaevvvvpvde.dglldlealeaaleehrtklvilehvnn
00502611   1/1  lgpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlelalral.lgpGdevlvpdpt
00367801   1/1  ggnplrealeeklaelegaeealvtssgtaAieaallal.lkpGdevlvpeplygstlellralakllGa
00501571   1/1  alaealdrlgngssygptpgveelrealaellgadpaevlftnggteAlelalkaarllgpgdevlvpep
00506961   1/1  aldsggalllgygdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalral.lgpGdevlvp
00490701   1/1  algaallsplkpgdevlvsalehgsvlaalallaerlGaevvfvdv......idlealeaal.tpdtklv
00503901   1/1  ypdpaglpelreaiaellgrrygvdvdpeeeilvtnGgtealelalral.ldpGdevlvpdptYpgylaa
00412601   1/1  leeleealaellgaeevlltsggtaaif.allal.lgpGdevlvpaplygsylalarlalkrlGaevvfv
00421441   1/1  aeivftsggtealelallalrayglkpgdevlvsslehgsvlraaellerlGaevvlvpvdp.dgrldle
00352461   1/1  DlltDsgtsaasdaqlaallvgddayggdplafeleealaelfgldavlftnsGteAnelalkallayhr
00473401   1/1  .lkpGdevivsdpaygstlallrllleraGaevvfvdld......dlealeaai.tprtklvllespsnp
00520701   1/1  ralgpgdevlvdelahhsildgarllgaevvvvphn......dldaleaalteagpprtklvvlesvnnp
00480741   1/1  lrellaellgadedaeevlltsggtealeaallal.lkpgdevlvsdpahgstlyakaakllGaevvfvp
00494861   1/1  llal.ldpgdevlvsepahpsvleagaaellGakvvpvp..dedgkldledleaaitedtahgllpklvv
00460561   1/1  lalaaahlkpgdevlvsalehpsnlaalrllaerlGaevvvvpvdp.dglldlealeaal.dprtklval
00507541   1/1  sknlgvdplfyldgaattpvppavlealaealtagnpysphelsqgaleleeelaerlaellgadaaivf
00465841   1/1  dpeeviftssgtealnlalkalrlgpgdeilvsalehpsvleaarllaerlgaevvfvpldeevdglldl
00528621   1/1  svgepdfppppavlealaealdgllgypppaglpelreaiaeylerrygvgvdpenilvtnGatealfla
00465471   1/1  iiftsggtealnlallalrrallkpgdeilvsspehpsvlkaaellerlgaevvevpvde.dgrldleal
00474411   1/1  al.lgpgdkvlvpapgyfsvrlaelaerlgaevvvvpvdp.gglvdpeale....tpdtklvllthpenp
00507681   1/1  delglgllgYpdpaGlpelreaiaeylarrrgvpdpeqilvtnGatealalllral.ldpGdevlvpspt
00485711   1/1  ylDflagigvvnlGhnhpevveaiadeeqldkllhvallsngaphepaeelaeklaelapegldkvfftn
00517571   1/1  lfgaeaalvtssgtaAillallal.lkpgdeilvsrglyhgslihglklsgakvvfvd........dled
00358461   1/1  ggldllygpsggileleealaelfgaddaifvtnGtseanlavilallgpGDevlvdrpsHksilnggar
00507531   1/1  alrltpgdevlvpdgahpsnlaalqtlaallGaevvvvpld......dlealeaald.edtaavllehp.
00370391   1/1  tnkYaeGypgkryygGneyvdelEdlaieralelfglepalwfanvqphSGsqAnlavllAl.lkpgdti
00500761   1/1  eleeklaellgaeaavlftsgGteAnllallaa.repgdevivsataHisvleagailglggakvvlvpv
00460241   1/1  nGgtealllalral.ldpGdevlvpdptYpgylaaaelaGaevvpvpldeeggflldldaleaai.tpkt
00470951   1/1  laellgadpgeevvftgggtealeaallgl.lkpgdkvlvssnghfsvllaeiaerlGaevvvvpvde.g
00462061   1/1  fagyrggygysrlrnptaealeralaalegaeevvltssgtaAialallal.lkpGDevlvsdplyggtl
00375691   1/1  al.lnpgdelvlvpdptYpgylaaarlagaevvpvplde.dfgldlealeaal..pktklvvlpnpnNPt
00354011   1/1  ealaegllgYpdpaGlpelreaiaellarrygllvgvdpeeilvtnGatealelalral.ldpGdevlvp
00389521   1/1  aeald.gllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllral.ldpGdevlv
00521641   1/1  ellgadpyeeivftgggtealeaallnl.lkpgdkvlvssnghfsvlaaeaaerlGaevvvvpv.dpggl
00423831   1/1  gnpllprflgavtsmpaeaaelltealnknlldpdvspgtaeleeevvsmlarllgapadnleealGaft
00476701   1/1  teAnllallaardralprrkaeglaalgleglpglvilvsdpaHysvekaarllGlgvrlvpvde.ngrm
00517231   1/1  teyvdeieelaieralelfgadyllwganvqphSgsqAnlavllal.lkpgdtilglslahGGhlthgsl
00513231   1/1  gYpdpaGlpelreaiaeylarrygvgvdpeeeilvtnGatealalllral.ldpGdevlvpsptYpgyla
00451711   1/1  alalrllal.lnpgdevlvpdptypgylaaarlagaevvpvpldeengfgldlealeaalaeatektkll
00453921   1/1  evvealkeqleklgytssggttelaealaellaellpldrvfftnsGseAnelalklarayylakgrlgt
00509771   1/1  dgllgYpdpaGlpelreaiaellkrrrgvgvdpeqilvtnGatealalllral.ldpgdevlvpdptYpg
00460891   1/1  lreaiaeylkrrygvgvdpdeilvtnGatealflllral.lnpGdevlvptPtYpgylaaarlagakvve
00475811   1/1  al.lqpgdevlcdelaHilldeagalefls.gaklvplpgedgkldpedleaairdddvhfprtrlvsle
00428091   1/1  hpevvealaeqldrllhgsflggltelavelaerlaellplgldrvfftnsGseAneaalklarayalak
00479561   1/1  gvdpeeilvtnGatealalllral...pgdevlvptptYpgylaaarlagaevvpvpl.dndfgldldal
00428061   1/1  ealalalrllal.lnpgdevlvpdptypnylaiarlaGaevvevpldeendfgldldaleaalteapekt
00405261   1/1  lslallal.ldnltnlllkpgdevvvpdptYpgylrlakllgakvvfvdl.......dlealekai.tpk
00357001   1/1  llnl.lgpgdkvlvlvtghfgnraadlakrlgaevvvvpvdegg.lldleeleaalidpdtklvalth..
00456391   1/1  .lnpgdevlipdptypnylaaaklagakvvpvpldeengfgldlealeaaleeatektkllllnnphNPt
00462551   1/1  glpelreaiaeylkrrygvgvdpdnilvtnGasealflllralldpgdevlvpsPtYpgylaaarlagak
00521571   1/1  araytgrdkiisfeggYhGrtlgalsltgspadrlgfapllggvrlpapdtyrvpyn.dlealealleel
00529431   1/1  araytgrdkiisfeggYHGrtlgalsltgsgayrlgfaplpgvprlpapdtyrvpyn.dlealeallaeh
00519931   1/1  iftgsgtealeaalanlllllkpgdkvlvsanghfsvr..waeiaerlgaevtvllpvdwgg.pvdleei
00452311   1/1  krflkgklnpgdevlvpdptypnylaiaelagaenvvevplddendfgldldallaalekatpktkllll
00450681   1/1  allnpgdevlvpdptypnylaiaklagaevvpvplddengfgldleallaalteapektklll.lnnpnN
00445231   1/1  pelreaiaellgrryvdpeeilvtnGatealalllral....gdevlvp.PtYplyaaaarlagaevvev
00516011   1/1  pevveaikeqldklghvsfgfttepavelaekLaellpaglekvfftnsGseAneaalklaraytgrdki
00355861   1/1  llnl.lgpgdkvlvlvtghfsvraaelakrlglevvlvldaeagglvdleeleealidpdtklvalthne
00350731   1/1  krflral.lnpgdevlvpdptypnylaiarlagaenvvevplddentfgldldallaal-----------
00503401   1/1  ellrellnapddyevlflsGggtgafeaallnllgpgdkvlvlvtghfsnraadeakrlgaevvvldadd


                         +         -         -         -         -         *         -:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
00459091   1/1  nptGnvadldaiaeiakkhgllvieDaayalgalyk...g..kkvgsfgdivvfSfsktKnltg.gegGa
00527311   1/1  adldeiaeiakkhglllieDaaqalgalyk...g..kklgsfgdivvfSfhatKnltg.gegGavvtndk
00408971   1/1  eaiaelarehgllvivDaahalgalyggrh.....pgslga.divsfsasKtltggg.gGavvtndeela
00417041   1/1  adleeiaeiakehgillieDaaqalgalygglk.....aggfggadifsfslsKtlggg.ggGalltnde
00523021   1/1  kpvfvdlde.....dlealeaai.tpktkaiilehpsnptGtvadleaiaelakkhgilvivDeaqatg.
00459731   1/1  devlvpslahggstlaaarllGagvnfsgllfkvvfvdvddetgnidledleaaitepktkaiivvasnp
00440831   1/1  kpvfvdvde.dgnldlealekaitevgaektkaiileppanptGvlplspadlkaireiadkhgillivD
00460871   1/1  hggfletggaallsgatpvfvdydlvdpdtgnidlekleaaikevgapktkliilenpvnpaGgsvysla
00461541   1/1  gstfdatalalsglgaepvfydvdpetglidpdaleealr.ertpaiivagvsaygrladlkelreiade
00487471   1/1  vldleeaiaelakkhgillivDeayalgvlgdp.....lelga..divvfSf..sKalgGptGlrgGalv
00401341   1/1  fvdvdpetglidlddleaair.prtklivlehsnptGrvadleeiaelaheygallivDeAhaagllalg
00489521   1/1  vlvpdptypstlaaarll.akvvgvpvdedggl.dlealeaaietpktkavilespnnptGvvldleeia
00495241   1/1  ivsapehpstlaawrllaerlGaevvfvdvde.dglidlealeaai.tpkTklvalvhpsnptGvvlple
00380341   1/1  aevvfvdld......dlealeaai.tprtklvvlespsnptgtvadleaiaelahkhgalvivDeayatg
00461651   1/1  edgg.ldlealeaait.pktklvvlenpnnptGvvldleeiaelakelghgallivDeayalgvlgdple
00393411   1/1  lvnpnNptGtvldleelealaelarehgllvivDeayaelaydgrpapsllsldpdalgrdivvfSf..s
00533351   1/1  pgylaaarlaGakvvfvpldedgtfgidlealeaaiteapktkaiilepnpnnPtGvvlpleeleelael
00467471   1/1  gpgdivlvdelnHgstldglrlsgaevvfvphn......Dldaleallkelreegpkpkliivegvfsmt
00460071   1/1  tHgstldglrlsgakvvfvphn......dlealeaalaeatprtkavvvesvfsptGdiaplaeiaelar
00511951   1/1  rfGaevvfvdld......dlealeaai.tpktklvvlespsnptgtvldleaiaelahehgallivDeay
00445951   1/1  kvvfvpldleedgflldlealeaai.tprtkaillvnpnNPtGavldleelealaelarehgllvieDea
00355891   1/1  vfvpldpdgtfgldlealeaai.tprtkaiilenpnNPtGtvldleelealaelarehglllivDeayag
00364061   1/1  ptGvvadlkeiaelaheygallivDeahaagllgldgrppgel.......gaDivtgslhKtlgGprg..
00497541   1/1  llGaevvfvpldedgflldlealeaalte.ktkavileppnnptGvvlpleeleelaelarehgillivD
00416741   1/1  pldedngfgldlealeaai.tpktkavilenpnNPtGvvldleelealaelakkhglllivDeayaglv.
00469651   1/1  aaarlaGakvvfvpldeeggflldlealeaai.tpktkaillpnpnNPtGavlsleeleelaelarehgl
00448071   1/1  ptGvvlpleeiaelarehgallivDeaqalgal.pgdldal.......gvdivvfslhKalggglglGal
00502611   1/1  yhgylaaarllGaevvfvpldedg..ldlealeaalteagadgllpktkavilepnpnnptGvvlppeel
00367801   1/1  evvfvdld......dledleaai.tpktklvllespsnptgtvldleeiaelahenhgalvivDeayaag
00501571   1/1  ayHgstlaalrlagakvvevtfvpldpdglllpypdlealeaai.tpktaavileppqnptGvvlpspey
00506961   1/1  sptYpaylaaarlagakvvpvplde..fgldlealeaalteakekgpktkaiilvpnpnNPtGavlslee
00490701   1/1  llthvsnptGvlldieaiaalahehGallivDaaqaagll.pldvgelg.....aDfvvfsgh..Ktlgg
00503901   1/1  arlaGakpvfvpldedgllplllglendflldlealeaai.tprtkaiilpnpnNPtGavlsreeleala
00412601   1/1  d.......ldledleaai.tektklvflespnNptgtvldleeiaelakkhllnpgalvvvDeayatpvl
00421441   1/1  aleaai.dpntklvvlehpnnptGvvlpleeiaelahehgallivDaaqaagal.pldlgel.......g
00352461   1/1  akgepgdtviisngyhgttlehvslagakvvrvpfdpaldealllpedgnldledLeklikehgadniaa
00473401   1/1  tGtvldleeiaelahehgalvivDeayaag..llgdplel.......gadivvgslsKylgghgdlraGy
00520701   1/1  tGtiaplkeiaeladeygallivDeahaggvlgrtgrglaehlgvepdadivvgtlhKalGprg..Gala
00480741   1/1  lde.dglidlealeaaitegpktklvvlehpsnptGvvldleeiaelakehgallivDaayaagal.pld
00494861   1/1  ltnpnnptGtvyslepleeiaalakehglllhvDgayaggalpglgvsvael...dgaegadvvsfslhK
00460561   1/1  thvsnvtGvilplaeiaalahehgalvlvDaaqaagalpl.dlgel.......gaDfvvfsghKllGppG
00507541   1/1  tsggteAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarllGaevvevpvde.dgridleale
00465841   1/1  ealeaal.tpktklvvlehvsnetGvilplkeiaelakehnGdlsallivDaaqavgalg.ldlagl...
00528621   1/1  lral.lnpGDevlvpdptYpgylaaarlagakvvpvpldedgflldlealeaaitp.ktklillpnpnNP
00465471   1/1  eaal.dedtklvvlthpnnptGvilpleeiaelakehgpdallivDaaqaagvlp....ldldelg....
00474411   1/1  tGvvldlaaiaalarehgpdallvvDaaqslgalp..........ldldelgvdvvvgslqKalggppgl
00507681   1/1  Ypgylaaarlagakvvpvpldg..fgldlealeaalkeakeatpktkliylvpnpnNPtGavlsleelea
00485711   1/1  sgseaveaalklarqyglglggsrlvlgtlelheeleelladtgrekilvfsggyhgntlallal.tgpg
00517571   1/1  lekaikektklvvlpsnptgrilsledlkeiaeiakeygallivDeahgagl...vggpllpsplelg.a
00358461   1/1  laGakpvylptdrngfggiggirfkhldpealeealtelkpeglrplpktkavvltnp.nptGtvyplee
00507531   1/1  nptGvvldlaalaelahaaGallivDaaqaal.gllvdpgal.......gadivvgslhKllgPhglggp
00370391   1/1  lgldlshGghlthgsildgtklslsgklfevvpygvdpetglidydeleklarefkpkliiagvsaygrl
00500761   1/1  d.edgkldleaLeaairedtahvhgtrpvlveitgntetGtvysldeleeiaelcrehglllhvDgArlg
00460241   1/1  klivlpnpnNPtGtvlsreeleelaelarehgillivDeayaelvydgepkdalppslasldgl....gr
00470951   1/1  glvdlealeealkepktklvalthve--------------------------------------------
00462061   1/1  tllrllgarggivvtfvdg..ldlealeaaite.ktkliflespsNptgtvldlaaiaelAhevgallvv
00375691   1/1  Gtvlsleeleelaela.khgalvivDeayaelvygg....pllslldllgrvivlgslsKtlglaGlRvG
00354011   1/1  dptYpgylaaarlatgaevvpvpldeeggflldlealeaalteapegglktklvllpnpnNPtGtvlsre
00389521   1/1  pdptYpgylaaarlatgaevv-------------------------------------------------
00521641   1/1  vdlealeaaleepdtklvalthvets--------------------------------------------
00423831   1/1  sGgteanllallaarnralpkrkaaglgipgpeilvs.paHysvlkaarllgievrlvpvdendgrmdle
00476701   1/1  dleaLeeaieedtaaglipaavvatagttptGaidpleeiaeicrehgiwlhvDaAyggga.lpfpeyrl
00517231   1/1  idgvrlsasg.kglevvpygvdpetglidydeleklakehkpk.livagaSaygrladlkrlreiadevg
00513231   1/1  alrlagakvvpvpldelltggllseggflldlealeaai.tpktkliilnnpnNPtGtvlsreelealae
00451711   1/1  llnnpnNPtGavlsreeleelaelakehglllivDeayaglvygg.eedapsllaladalprvivlgSfs
00453921   1/1  ggdkilvfeggYHGrtlgalsltgspsylggfgplgagvvvvpyp......dlealeaaiepdtvaaviv
00509771   1/1  ylaaaelagakvvpvpldeeg-------------------------------------------------
00460891   1/1  vpldeegglflldlealea---------------------------------------------------
00475811   1/1  ntqntegGtvypleeleeiaelArehglllhlDGARlanalvalg...vslaelaglvdsvsvglsKglg
00428091   1/1  gtprdkilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvpapylyrteelgyndldaleallae
00479561   1/1  eaaiktpktkllllcnpnNPt-------------------------------------------------
00428061   1/1  kllllnnpnNPtGtvlsleel-------------------------------------------------
00405261   1/1  tklvflesPnNPtgtvl-----------------------------------------------------
00357001   1/1  netstGvlnpllakkhgallivDavssilarp..........idvdklgvdyasaqKnlGppG.lgvviv
00456391   1/1  Gavlsreelkelaelakehdl-------------------------------------------------
00462551   1/1  vvpvpldeengflflld-----------------------------------------------------
00521571   1/1  gddiaavivepvqgegGvipppp-----------------------------------------------
00529431   1/1  gdeiaavivepvqgegGviv--------------------------------------------------
00519931   1/1  eealdepdtklvalvhvetstGvlnd--------------------------------------------
00452311   1/1  nnpnNPtGtvltpeelkel---------------------------------------------------
00450681   1/1  PtGtvlsreelkelaelak---------------------------------------------------
00445231   1/1  pld.ngflldle......i---------------------------------------------------
00516011   1/1  isfeggYHGrtlgalsltgs.-------------------------------------------------
00355861   1/1  tstGvllpieeia....ehgallvvDaassigs..........rpidvsgvdvvvasaqKnlgppG----
00350731   1/1  ----------------------------------------------------------------------
00503401   1/1  ggl.ldleeleeallnpdtklvavthneTstGvlnpleei.....dhgallvvDavsslgslp.......


                         -         -         -         +         -         -         -:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
00459091   1/1  ivtndkelaeklrllrnhgtsksyhglkyvhlllgynyrlseiqAalglaqleklderlerrrenaklya
00527311   1/1  elaeklrllrnhgisrdglrkyvhlllgynyrlseiqAalglaqleklderlerrrenaklyaelLkdlp
00408971   1/1  erlrklrnhglsrgllllvlaalllryevlllgynyrlspiqaaallaaletlderlerrrenadrlael
00417041   1/1  elaerlrplrlggisidlkylvqelgfnsgtspiaaaaglaalegleeilerrreladylaeaLkelpgl
00523021   1/1  ...gllydglelg..adivvfSf..sKylggtGdrlGglvvtndkelierlrplrsggtsisyvglvtld
00459731   1/1  GviadleeiaeiakkhgallivDaAhalgavgldvlp.....gplggaDivsfslhKtlgg.ppGGallv
00440831   1/1  eahaaglaytgklfgseyagvaigelvpdlfggadivsfslsKtlggp.rgGailtndeeladklrklrf
00460871   1/1  dlkaireiAdkyglllivDaAraagaly.....aggvtgspyafrsigeivdeifgyadivsfslsKglg
00461541   1/1  vgallivDaAhaaGlvaagvlp.....spfggadivtftthKtlrGprg..Gailtrdelldellrllrg
00487471   1/1  gndelieallkllrgggg...........ggtlsplaaaallaaletleerlerlrenadllaeaLeelp
00401341   1/1  lhglple........gadivvgslhKtlgGp.rgGailvrd.elaeklrsllfgg..........gfggt
00489521   1/1  elakehgallivDeayaggalgdplel.........gadivvgslsKalggpaGlrgGalvgnd.eliea
00495241   1/1  eiaelahehgalvivDaaqaagalpid........ldelgaDfvvfsahKwlgppG.iGalyvrkelldk
00380341   1/1  vlgd.....plalg..adivvgsl..sKalggpgdrlgGyvvgsde.liealrklrlgg..........g
00461651   1/1  l.........gadivvgslsKtlngpgGlrgGalvg.ndeliealrk............vrrglggtlsp
00393411   1/1  KtlglpglrvGylva.dpeliealrklrsgg............gstpsplaqaalaaaledgeehleelr
00533351   1/1  akkhgillivDeayagfa...ydlggkgpsllelldlgpdvivlgSfsKalglpGlrvGalvgpdeelll
00467471   1/1  GdiaplkelreladkygallivDeahaggvlgatGrgllehlgvlpdadivtgtlsKalggg.rgGailg
00460071   1/1  khgallivDeahaggvlgrtgrgllellglgadivvgtl..sKalGg..rgGavlg.seelidalrplar
00511951   1/1  aag..vlgd......plelgadivvgsl..sKalggpgdlrgGylvgs.eeliealrklllgg.......
00445951   1/1  yaelv.ydgpfpsladlda...grvivlfSfsKtlglpGlrvGylva..ppeliealrklrslg......
00355891   1/1  lvydgklpgslaeldg..vdivlgsf..sKalglpGlrlGylva.dpeliealrklrsggt........l
00364061   1/1  Gyiagkdelqelieklrrlkap..........lgfgtalspliaaaalaalelleegleelaerlvenaa
00497541   1/1  eayagfvytgklpvslael..lgvagadivvgSf..sKalglpGlrlGalvg.deelidalrklrrggt.
00416741   1/1  ..ydg...kplsalalldalgrvivlgSf..sKalglpGlrlGylva.dpeliealrklrsgg.......
00469651   1/1  lvieDeayaelvydgkpapslasldglldrvivlgSfsKtfglpGlRlGylva.ppeliealrklrspg.
00448071   1/1  lv.seellerlrpllsggtslyldlllllkyeqerrfragtpnplaaaallaalellleeglealrarla
00502611   1/1  ealaelarehgallivDeayagfvytgkpagslaaldelgv..divlgsl..sKtlggglrlGalvg.de
00367801   1/1  vlld........plelgadivvgsls..KylggpgdlrgGyvagsee.liealrklrpgg..........
00501571   1/1  leelaelarehgallivDeayagfgrtglpfap.........ealgvdivigslsKalg.gglglGavlg
00506961   1/1  leallelarkhdllvieDeayaelvy......dgkpfpslasldepdrvivlgSf..sKtl.lpGlRlGy
00490701   1/1  gppglGflyvreellerlppllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalellgle
00503901   1/1  elarkhglllieDeayaelv.ydgkpfpslasldge.ygrvivlgSf..sKtlglpGlRlGyvva.ppel
00412601   1/1  gd........plelgadivvhSl..sKalggagdlriGyvvgnde.lidalrklrgpl...........t
00421441   1/1  aDivvfsahKylggpg.lGallvrd.ellerlrpllhgggl.....ekrfeagtpnplaiaallaalell
00352461   1/1  vileptqnptGgqvpsleylkelreiakkhgillilDearlaenayfgfgrtgslfaleiagivpdilt-
00473401   1/1  lagre.elidklrgllvg..........lgggt.lspaaaaallaaletlelrreralenadylaelLae
00520701   1/1  gs.eelidalrplargg..........tfsgtlnplaaaaalaalellgeegleelrerlralaaylaeg
00480741   1/1  plel.......gaDivvfslhKalggppgvGallvr.kelieklrpllpgglldlvlalkylgavlgfft
00494861   1/1  tlggpg.gGallv.rdelaealp..........llrggggetgrrsgllaaaalaalglegleelaarlr
00460561   1/1  .vGflyvrk.ellerlppllvgggqvaavsldlalqlrllerrfeagtpniagiaallaalellgeegle
00507541   1/1  aai.dertaavvltnpnnptGviepleeiaelahehgallivDeayaggl......glgvdpgdlg.aDi
00465841   1/1  ....gvDivvfslhKalggpggiGalyvrk.elldrlrpllhgggslilvvrfdsltlqelglrfefgtp
00528621   1/1  tGtvlsleelealaelarkhglllivDeayaelvfdgepppsl...ldalgrvivlgsfSKtlglpGlRl
00465471   1/1  vDfvvfsghKalgppg.iGalyvrkell....lrpllvgggqerrfeagtpnvlaiaalaaalellgegl
00474411   1/1  Gflavspellerleplsgylglallldlqekrfepgtppvlaiaallaalellleeglerrarlaelada
00507681   1/1  llelarkhdllvieDeayaelvydgapfpslasl...dapdrvivlgsfSKtl.lpGlRlGylva.ppel
00485711   1/1  devlvpdplypgylhaallagarvvfvpldvded.ghldlealeaaleeldaggdrtaavilepvqnptG
00517571   1/1  DivvgSlhKtlgGp.rgGyiagk.kelieklrkvfpglg............gspsplvaaallaalktll
00358461   1/1  iaelakkhglyllvDeAhgagayggpgrglaehlglpplaleagadivvgslhKtlgaltqtGwlhvrgg
00507531   1/1  gaGalavreellralpgrlvgvtgdadgkralrlalqtreqhirrekgtsnictpnglaaaaalaaldll
00370391   1/1  adlkrlreiadevgalllvDaAhiaGlvaagvh.....pspleyadvvtttthKtlrGprG..Gliltr-
00500761   1/1  nalgal.....gvdlaeldgaegaDsvsfslhKglgapg.ggallgrdeli...........ekarllrk
00460241   1/1  vivlgsfSKtfglpGlRlGylva.peeliealrklkggg...llraltlsvstlaqaaaaaaledglee-
00470951   1/1  ----------------------------------------------------------------------
00462061   1/1  Dntyaapll.........ldpldlgadvvvhsttKklgghggvrgGylvgnpel...........laall
00375691   1/1  ylva..ppeliealrklrsp..........lgvstlaqaaaaaaledgllehleelrerlaerrdllle-
00354011   1/1  eleellelarehglllivDeaya...elvfdgapfpslaslllelglrllpdaygrvivlgsfsKtlgl-
00389521   1/1  ----------------------------------------------------------------------
00521641   1/1  ----------------------------------------------------------------------
00423831   1/1  aleaai.dentalvvatagttptGaiddieeiaelaeeygletglgiwlhvDaAy.ggfllpfleklrpl
00476701   1/1  lldg.iegaDsitfslhKwlgvplgcgallvrdkellrralsvdadylgslddggdgvrdlrdftlegsr
00517231   1/1  alllvDaAhiaGlva...ggllp..splegadvvtttthKtlrG.prgGliltrkglldllrqkgrlily
00513231   1/1  lakkhglllisDeayaelvydgapftsllslpdaldrvivlrSfSKtfglpGlRvGylvappeliealr-
00451711   1/1  KtfglpGlRvGylva..ppeliealakvksqllllir.gltlnpptlaqaaaaaaledgalreeweeele
00453921   1/1  epvqgegGvivpppeflkalrelcrkhgillivDEvqtgfgrtgklfaf........ehlgvtpdivtls
00509771   1/1  ----------------------------------------------------------------------
00460891   1/1  ----------------------------------------------------------------------
00475811   1/1  apv.Gavlvgdkdliekarrlrkr...........lggglrqagvlaaaalvaledllellaeaherakr
00428091   1/1  hgekiaavivepvvqgegGvivpppeflkalrelcdkhgilliaDEvqtgfgrtgklfafehagvt....
00479561   1/1  ----------------------------------------------------------------------
00428061   1/1  ----------------------------------------------------------------------
00405261   1/1  ----------------------------------------------------------------------
00357001   1/1  sedllerlepilpgyldyktvakngstanTp.ptlaiyalgaalewlleeggleaiearhaelaallyea
00456391   1/1  ----------------------------------------------------------------------
00462551   1/1  ----------------------------------------------------------------------
00521571   1/1  ----------------------------------------------------------------------
00529431   1/1  ----------------------------------------------------------------------
00519931   1/1  ----------------------------------------------------------------------
00452311   1/1  ----------------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------
00516011   1/1  ----------------------------------------------------------------------
00355861   1/1  ----------------------------------------------------------------------
00350731   1/1  ----------------------------------------------------------------------
00503401   1/1  ...idvdklgvdffsaqKnlG.ppGlgvlivskdllerlepl..gpsyldlvtlak..kgstanTppvla


                         -         *         -         -         -         -         +:350
query           VEEKGFRYHVFHQYVVLFENEEVRERVREGLKERGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
00459091   1/1  elL..kklpgvelpkppglashsayylfpillkdglglsrdellefllkkgietrphyp.plhlqpaykn
00527311   1/1  g...vklpkypglassvyhlfsillkdgleasrdeliealkekgiltrvgy.iplhlqpaykkl.yklgd
00408971   1/1  Laelpgvelvkpp....glsshafylfailvlllglgldrdelaeaLeeagiavvpgya.plhlqpaytt
00417041   1/1  elvgppg......lsaphlfpvllplpeltelllplgglllwlfllegidreelakalleagiavrpgsa
00523021   1/1  llprrfeagtpnvagliglgaalsplqaalllrgletldlrlerrrenadylaegLaelpgvelvlypgl
00459731   1/1  nd.elieklrplrvgglfdlekligrarryffsgtppgarlaalaaalgllglegleerlerrrelakyl
00440831   1/1  pg.....egfplgggyrgspiaaaaallalelleellerrvenakylaeaLeelgvpvvgpv......gg
00460871   1/1  g.prgGaivtndeelakkarklrfpg.....egfllgggprqhgiaaaaallalaeleeylerrhenary
00461541   1/1  fgfdlakkinsavfpglqggplnhviaalaaalklaqleefkeyaeqvvanaralaeaLaelgfklvsgg
00487471   1/1  gvtlvlypglpshpghelakklvpggg.....gllsvelkdgedaeelldalkeagiavslgsafslill
00401341   1/1  lspllaaallaalelleeglkerrerlvenaarlaeaLeelgfvvvvgppd........ghlvsvdlpgl
00489521   1/1  lrklrs............ggggtlsplaaaallaalegleerrerlrenadylaeaLae..lggvelvl.
00495241   1/1  llpllrggggivlvslfgltaaeqerrfeagtpnvaaiaalaaalellqeegleairerhreladylleg
00380341   1/1  fggtlspaaaaallrgletlelrrarlrenadllaeaLaelpgvvlvlypglpshpghelakrqlpgggg
00461651   1/1  laaaallaalegleerrerlrenadrlaeaLaelpgvervlypglpphggfflwvdlpegrgglvsfrlk
00393411   1/1  erlrerrdllaeaLaelpgvevvgppg........gfflwvdlpglgldaeelaeaLleeagvavrpgsa
00533351   1/1  lalliealrklrrpgt.........gspsplaqaaaaaaledlelrghwlael-----------------
00467471   1/1  s.kelidklrslarpg..........ifstslnplaaaaalaalelleegeelrerlrenaeylregLee
00460071   1/1  gg..........tfsgslnplaaaaalaalelleeegleelrerlaelaarlregLaelglevv.pgl..
00511951   1/1  ...glggtlspaaaaaalagletleerrarlrenadrlaeaLaelggvalvgypglpshpghelakkvlp
00445951   1/1  ..glgvstlaqaaaaaaledglflehleelrarlrerrdllleaLaelglrvlkpeg.....gfflwldl
00355891   1/1  gpsplaqaaaaaaledlelleehleelrerlrerrdrlaealaelglevvgpg........gglflwvdl
00364061   1/1  ylaegLkelgfvvvvgppg........ghivlvdlpgdgidakalakaLeeagiavrpgsfptvpegsgv
00497541   1/1  ...........ftlsplaqaaalaaledleehleelrerlrelrdrlaeaLeelglevlvpg........
00416741   1/1  .....tfgpsplaqaaaaaaledeleelrerlrerrdllaeaLeelglevvgps........ggfflw.l
00469651   1/1  ...........nssvstlaqaaaaaaledgeflehleelrerlrerrdllleaLaelglevlppe.....
00448071   1/1  eladylaegLeelglelvgppgr......rsgllvsfdlpdgvdaeelakaLleeygiavspgsafasp.
00502611   1/1  eliealrklrhggt............ftgnplaqaaalaaledlaleehleel-----------------
00367801   1/1  glggtlspaaaaallrgletlelrreraqenadylaelLeelglvvlvyypglpsgafyllaklpakgrg
00501571   1/1  sd.eladalrplr............rgltfggnplaaaaalaalelleeeelrerlreladylaegLael
00506961   1/1  lvappeliealrklrs............gltlgvstlaqaaaaaaledggyeehleelrarlrerrdlll
00490701   1/1  gleaiaarhleladylaegLaalpavpglellgpp....daarr.gglvsfrlpg...aealakaLdeag
00503901   1/1  iealrklrsal............tlgvsplaqaaaaaaledgelrlerleehleelrarlrerrdllaea
00412601   1/1  gstlspaaaaaalrgletlelrrerlaenaallaeaLeelgpgvevvlypglppegahylalrvlklpga
00421441   1/1  geglealraralelaeyl........regleelpglelvgppgrrlggivsfelpgvdaedl.lllergi
00352461   1/1  ----------------------------------------------------------------------
00473401   1/1  lpgvylvgypglpshpghelakkvlpg..........rggfvsfdlkggvdaealadaLeeagiavslgs
00520701   1/1  Laelglpvvggl..........gaivlvdlgdgvdakalaaallleaGilvrpgsapa............
00480741   1/1  gtpnilgiaalaaalellgeeggleeilerlreladylyeglkelglellgpdgr.....grggivsfrl
00494861   1/1  eladylaegLaelglelvgppg.........anivfvdlp.gvdaeelaaalleagiavspg.....g..
00460561   1/1  airarlraladylaegLaalpglellgp..e......rrggivsfrlp.gvdaedlakaldeygiavrtg
00507541   1/1  vtlslhKtlggpkgggGprlGallvrdelaealplrlggggergfvltldreqairrglagtgnalaiaa
00465841   1/1  pvaaaaalgaalelleeeglleairerlreladylregLeelpglelvgppg.......grgpivsfelp
00528621   1/1  Gylvappeliealrklkspl........tlgvssla----------------------------------
00465471   1/1  eairarlleladyllegLkelpglellgppg.......rrgnivsfrlp.gvd-----------------
00474411   1/1  lragleal.glell.peg.......rsggvvsfrlpdgidaaalakaleeagiavspgsafl........
00507681   1/1  iealrklrs........lltlgvsslaqaaaaaaledglydehleelrallre-----------------
00485711   1/1  vvlppeeylkelrelarkhgillivDeayagfgrtgkpf..alellgvddrpdivtls.hKalg..G..G
00517571   1/1  lrgfkryleealklakalaeylyeglkklpglegfk----------------------------------
00358461   1/1  yiagpkelidalrfnraysllystspsyplqaallaalellageegeelrerlieladylrkaLkklgfl
00507531   1/1  gleglearaeralalanylaaaLeelpgvrvlgpg........gaghevsfdl..gvdaedvakallerG
00370391   1/1  ----------------------------------------------------------------------
00500761   1/1  rlggllrqagllaaaalaalgeegleellaranalarrlaegLaalpglelvgppe.........tnivf
00460241   1/1  ----------------------------------------------------------------------
00470951   1/1  ----------------------------------------------------------------------
00462061   1/1  kvlprllggplspfqaalllrg.letlplrver-------------------------------------
00375691   1/1  ----------------------------------------------------------------------
00354011   1/1  ----------------------------------------------------------------------
00389521   1/1  ----------------------------------------------------------------------
00521641   1/1  ----------------------------------------------------------------------
00423831   1/1  dfglpgvdsisvsghKyglaplgcGvvlvrdkell-----------------------------------
00476701   1/1  rfralklwaalralgreglrelierlielarylaegLrelpgfellgepe...-----------------
00517231   1/1  elakkinsavfpglqggpllhviaalavalkealepefkeyakqvvenak--------------------
00513231   1/1  ----------------------------------------------------------------------
00451711   1/1  elrarlrerrdllvealaelplpgglev------------------------------------------
00453921   1/1  Kalgggglplgavlg..seeiadalgpllhggt-------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00460891   1/1  ----------------------------------------------------------------------
00475811   1/1  la--------------------------------------------------------------------
00428091   1/1  .....pdivtlsKalgggglplgavlg.seeiadal----------------------------------
00479561   1/1  ----------------------------------------------------------------------
00428061   1/1  ----------------------------------------------------------------------
00405261   1/1  ----------------------------------------------------------------------
00357001   1/1  l...dalglvyllvvdpelrsgmvv..sftlpdgvlakaflkllkeegiavlkGhrcv............
00456391   1/1  ----------------------------------------------------------------------
00462551   1/1  ----------------------------------------------------------------------
00521571   1/1  ----------------------------------------------------------------------
00529431   1/1  ----------------------------------------------------------------------
00519931   1/1  ----------------------------------------------------------------------
00452311   1/1  ----------------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------
00516011   1/1  ----------------------------------------------------------------------
00355861   1/1  ----------------------------------------------------------------------
00350731   1/1  ----------------------------------------------------------------------
00503401   1/1  iyalglalewlkeeggleaiekrhaelakllydaldalglvyllgvdpelrsptvvtfnlp..dgvdakd


                         -         -         -         -         *         -         -:420
query           RSLALPMFPELRDDEIKEVVDTIALFL-------------------------------------------
00459091   1/1  lgyaigpastthadlpnaeklakrvls-------------------------------------------
00527311   1/1  lpvaeglakrllrLplhpglteedidyi------------------------------------------
00408971   1/1  .glrlgdlpvaeglgegllrlsvgpalt------------------------------------------
00417041   1/1  .plhplpayl..gyvlgalpvaerlgeg------------------------------------------
00523021   1/1  pshpghelakrqlpggaggll..s----------------------------------------------
00459731   1/1  aegLkelglevlgpgldshp......g-------------------------------------------
00440831   1/1  hgvfldlellldgitgdelaealleag-------------------------------------------
00460871   1/1  laeaLkelgipvvgp......tgghlv-------------------------------------------
00461541   1/1  ........tdnhlvlvdlrdlgldgkela-----------------------------------------
00487471   1/1  pasttllalglelllalgisegllrls-------------------------------------------
00401341   1/1  gidaldlakaLeeagiavrlgshPavp-------------------------------------------
00489521   1/1  ppglpshpghylavrlprglglllsf--------------------------------------------
00495241   1/1  Lkelpgvllvgppgas....yrl-----------------------------------------------
00380341   1/1  ivsfelkgdgedaeafadaLkea-----------------------------------------------
00461651   1/1  dgidaealakaleeagifviavspgsa-------------------------------------------
00393411   1/1  f......................g.gp-------------------------------------------
00533351   1/1  ----------------------------------------------------------------------
00467471   1/1  lglpvgpsd..........ghivlvdl-------------------------------------------
00460071   1/1  .......glivpvelgdgldalalaea-------------------------------------------
00511951   1/1  g..........rggfvsfdlpgggedae------------------------------------------
00445951   1/1  p........daelarllleagvavrpg-------------------------------------------
00355891   1/1  pdlgldaeelaealleagvlvrpgsaf-------------------------------------------
00364061   1/1  tsglrigtpaltarglseeef....gl-------------------------------------------
00497541   1/1  gglflwvdlpdllgvdaeelaealle--------------------------------------------
00416741   1/1  dlp.gldaeelaealleagvlvrpgsa-------------------------------------------
00469651   1/1  ...ggfflwvdlpelgldaeelaerll-------------------------------------------
00448071   1/1  ..........................gv------------------------------------------
00502611   1/1  ----------------------------------------------------------------------
00367801   1/1  gllsfelkgdaeavaklldelgvavrpg------------------------------------------
00501571   1/1  glelvgpv.rggglflfvel.......p------------------------------------------
00506961   1/1  ealkellppglevvppe........gg-------------------------------------------
00490701   1/1  iavslgsac..................-------------------------------------------
00503901   1/1  leelglkvvppeggfflwvdlpel...-------------------------------------------
00412601   1/1  ggivsfelkgdaealaalldelgiavrp------------------------------------------
00421441   1/1  avspgsacslgllppslvll.......-------------------------------------------
00352461   1/1  ----------------------------------------------------------------------
00473401   1/1  afslilhpastthaalglelraalgigp------------------------------------------
00520701   1/1  ........vplgpgrlRislgaattee-------------------------------------------
00480741   1/1  pdgidaaakalakalleagiavspgsa-------------------------------------------
00494861   1/1  ....................pgalRl--------------------------------------------
00460561   1/1  sacaspllepllv..............-------------------------------------------
00507541   1/1  aaaalrllgeeglkelaerlveladyl-------------------------------------------
00465841   1/1  ggvdaeelakaLdeagiavragsap.--------------------------------------------
00528621   1/1  ----------------------------------------------------------------------
00465471   1/1  ----------------------------------------------------------------------
00474411   1/1  ...............aggtlRislggy-------------------------------------------
00507681   1/1  ----------------------------------------------------------------------
00485711   1/1  av.g.seelidalrpl...........-------------------------------------------
00517571   1/1  ----------------------------------------------------------------------
00358461   1/1  flpsdspivpvilpegafylfakiddf-------------------------------------------
00507531   1/1  vavstgsfpglv...............-------------------------------------------
00370391   1/1  ----------------------------------------------------------------------
00500761   1/1  frlpge.....llerllergiavspg.-------------------------------------------
00460241   1/1  ----------------------------------------------------------------------
00470951   1/1  ----------------------------------------------------------------------
00462061   1/1  ----------------------------------------------------------------------
00375691   1/1  ----------------------------------------------------------------------
00354011   1/1  ----------------------------------------------------------------------
00389521   1/1  ----------------------------------------------------------------------
00521641   1/1  ----------------------------------------------------------------------
00423831   1/1  ----------------------------------------------------------------------
00476701   1/1  ----------------------------------------------------------------------
00517231   1/1  ----------------------------------------------------------------------
00513231   1/1  ----------------------------------------------------------------------
00451711   1/1  ----------------------------------------------------------------------
00453921   1/1  ----------------------------------------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00460891   1/1  ----------------------------------------------------------------------
00475811   1/1  ----------------------------------------------------------------------
00428091   1/1  ----------------------------------------------------------------------
00479561   1/1  ----------------------------------------------------------------------
00428061   1/1  ----------------------------------------------------------------------
00405261   1/1  ----------------------------------------------------------------------
00357001   1/1  .............gglRislygavtle-------------------------------------------
00456391   1/1  ----------------------------------------------------------------------
00462551   1/1  ----------------------------------------------------------------------
00521571   1/1  ----------------------------------------------------------------------
00529431   1/1  ----------------------------------------------------------------------
00519931   1/1  ----------------------------------------------------------------------
00452311   1/1  ----------------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------
00516011   1/1  ----------------------------------------------------------------------
00355861   1/1  ----------------------------------------------------------------------
00350731   1/1  ----------------------------------------------------------------------
00503401   1/1  flklldeagiavlkGhrca........-------------------------------------------