[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD35944.1


[Show Plain Result]

## Summary of Sequence Search
   1::355
   1::308  3.9e-83 41.9% 0046877 00468771 1/1   otide-diphospho-sugar transferases      
   2::281  1.2e-74 41.9% 0051364 00513641 1/1   otide-diphospho-sugar transferases      
   2::292  1.6e-74 37.7% 0040693 00406931 1/1   otide-diphospho-sugar transferases      
   1::286  8.4e-69 36.6% 0047373 00473731 1/1   otide-diphospho-sugar transferases      
   2::307  5.5e-68 37.2% 0053095 00530951 1/1   otide-diphospho-sugar transferases      
   1::246  3.9e-67 39.4% 0044168 00441681 1/1   otide-diphospho-sugar transferases      
   2::235  8.5e-67 41.9% 0038427 00384271 1/1   otide-diphospho-sugar transferases      
   1::237  1.9e-66 42.3% 0038005 00380051 1/1   otide-diphospho-sugar transferases      
   3::298  2.4e-65 36.7% 0048137 00481371 1/1   otide-diphospho-sugar transferases      
   1::241  2.1e-62 43.0% 0038743 00387431 1/1   otide-diphospho-sugar transferases      
   1::236  1.4e-61 43.0% 0047707 00477071 1/1   otide-diphospho-sugar transferases      
   3::240  1.8e-57 36.9% 0050195 00501951 1/1   otide-diphospho-sugar transferases      
   1::235  1.3e-54 38.6% 0050178 00501781 1/1   otide-diphospho-sugar transferases      
   1::235  1.7e-49 36.8% 0050266 00502661 1/1   otide-diphospho-sugar transferases      
   1::235  3.5e-49 36.3% 0050387 00503871 1/1   otide-diphospho-sugar transferases      
   1::235    5e-45 33.3% 0038881 00388811 1/1   otide-diphospho-sugar transferases      
   1::243  8.4e-45 35.7% 0038462 00384621 1/1   otide-diphospho-sugar transferases      
   1::235  1.6e-44 36.3% 0044743 00447431 1/1   otide-diphospho-sugar transferases      
   1::236  8.7e-42 38.5% 0046659 00466591 1/1   otide-diphospho-sugar transferases      
   1::232  1.8e-37 37.4% 0046466 00464661 1/1   otide-diphospho-sugar transferases      
   1::235  9.2e-36 27.4% 0050366 00503661 1/1   otide-diphospho-sugar transferases      
   4::198  6.1e-24 27.6% 0049057 00490571 1/1   otide-diphospho-sugar transferases      
 201::336  9.7e-11 25.0% 0052621 00526211 1/1   ric LpxA-like enzymes                   
 208::335    8e-10 28.2% 0048541 00485411 1/1   ric LpxA-like enzymes                   
 200::333  2.3e-07 23.9% 0051363 00513631 1/1   ric LpxA-like enzymes                   
 235::333  1.3e-06 24.7% 0044607 00446071 1/1   ric LpxA-like enzymes                   
 246::317  1.4e-06 27.8% 0039338 00393381 1/1   ric LpxA-like enzymes                   
 249::299    3e-05 31.4% 0049600 00496001 1/1   ric LpxA-like enzymes                   
 246::331  5.8e-05 27.9% 0053166 00531661 1/1   ric LpxA-like enzymes                   
 253::335  0.00086 28.9% 0047244 00472441 1/1   ric LpxA-like enzymes                   
   1::355


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
00468771   1/1  mmkavILAGGlGtRlrPlTsalpKpllpvggkPlieytlerlaaagideivvvtgykdaelieeylgdgs
00513641   1/1  -lllllllmmkvmkavILAGGlGtRLrPlTkarPKpllpvggkyplidytlsrlanagieeivvvtgyka
00406931   1/1  -lkimkAvILAGGlGtRLrPlTralpKpllpvagkPlieytlerlaaagieeivvvtgylalelieeylg
00473731   1/1  MmkmkavIlAgGlGtRlgplTsdrpKpllplggkpliqhtlerllaagideivvvtgykarelieellgd
00530951   1/1  -dllrelleglllllklseldlesflalferlllellelldidlipllplelvvslldlellldleelgl
00441681   1/1  mkmkavILAgGlGtRlgplTsdlpKpllplggkPliehvlealaaagideivvvtgyka.elieellgdg
00384271   1/1  -mimkavILAaGlGtRLrpltralPKqllpvggkPliqytlerlaaagideivvvtgeylaelieellgd
00380051   1/1  kmkavILAaGlGtRlgplt...pKpllpiggkpllehvleallaagideivvvtgyka.eaieell....
00481371   1/1  --hmkavIlAgGlGtRlgpltsdrpKpllplggkpliehtlerllaagideivvvtgykaleliaellgd
00387431   1/1  mkmkavILAaGlGtRlgplt...pKpllpiagkpllehvlerllaagideivvvtgydd.elieellgdg
00477071   1/1  mmkmkavIlAaGlGtRlgplTsdlpKpllpvggkplieytleallaagideivvvtgyka.elieellgd
00501951   1/1  --kmkavIlAgGlGtRl.p.....pKpllplggkpliehtlerllaagideivvvtg...deeiaell..
00501781   1/1  kmkavIlAaggGtRl.p.....pKpllpiagkPliahvleallaagideivvvtgd...eeiaealgd..
00502661   1/1  mmkmkaiIlAaGkGtRlgp...dlpKqllplggkplleytleallaaglideivvvtgyed.elieell.
00503871   1/1  lkmkmkaviLAgGsGtRlgp...dlpKqllplagkpllqhtlerllaaglideivvvtgpedlelieell
00388811   1/1  mmkmkavilAAGlGtRmgp...dlpKpllplggkpllehvleallaaglideivvvvgygd.eaieella
00384621   1/1  MkvkavIlAaglGtRl.p.....pKpllpiaGkPliqhvieaalaagiidivvv..gtddeeiedaldk.
00447431   1/1  mmkmkavilAAGlGtRlgp...dlPKqllplggkpllehvleallaaglideiivvvgykd.elieella
00466591   1/1  MkkkilaiIlAagkGtRl.p.....pKpllpiggkpliehvleallksglideiivvtg...deeikeyl
00464661   1/1  MmkikavIlAgGlGtRlgp....lpKpllpiggkpliehvlerll.agideiivvtgyk.aelikkl...
00503661   1/1  kmaaiilAAGkGtRmgs...dlpKqllklggkpllehtleallslglidiivvvgneedlvlla......
00490571   1/1  ---pmkvaAiIlArGggkrl.p.....pKnllplagkpliaytleallasglideivVvtdd...deiae
00526211   1/1  ----------------------------------------------------------------------
00485411   1/1  ----------------------------------------------------------------------
00513631   1/1  ----------------------------------------------------------------------
00446071   1/1  ----------------------------------------------------------------------
00393381   1/1  ----------------------------------------------------------------------
00496001   1/1  ----------------------------------------------------------------------
00531661   1/1  ----------------------------------------------------------------------
00472441   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
00468771   1/1  llgvkityvlepeplgtagavllaldllgddpflvllgDhplidldlaelleahresgalatllvvpved
00513641   1/1  .esiedhlgdgselgldlklgglfvlllpanityvlepeplgtagalalaldllgdspdepflvllgDhl
00406931   1/1  dgselgvkityvlepeplgtagalllaldflgdepflvllgDhilldldlrelleahrekgalvtvllvp
00473731   1/1  gselglkvvyvlegeplgtadavllalealgddpvlvllgDrplidpdldelleahresgadvtvlvvpv
00530951   1/1  ellnkmkaviLAGGlGtRLgp...slPKpllpvgngkpllehilerlkalqkkagikveiiivtsyktae
00441681   1/1  sellsdllldlklellellrllleglkityvlqgeplgtagavllaldllgddepvlvllgDvpldedla
00384271   1/1  gselglkivyvvepeplgtagalllaldllgddpfvlvlngDilidvdlaelleaareegalatvllvpv
00380051   1/1  ..glkvtyvvqpeplgtagavllaldalgddddpvlvllgDvplitdedldelleahlesgadatvlvvp
00481371   1/1  gselglevtyvlqgeplgtadavllaldalgddpvlvllgDhplidpdleelleahresgadvtvlvvpv
00387431   1/1  .....nvtyvlqgeplgtagavllalellgddepvlvllgDvplvtpadlerllealaetg..atilvvp
00477071   1/1  ...ygvkivyvlqpeglgtagavllaldll..ddvlvllgDvpllld...lleahlesgalatvl...vk
00501951   1/1  .sklgvevvyvvedealgtgplaavlaalellgddpvlvllgDhplldpedldrllealresgadatllv
00501781   1/1  .ygvevvyvrqdealgtggavlaalelladgddpvlvllgDvPlitpelidrllealresgadaavlvvp
00502661   1/1  ....lgldilivlqpgglgtagsvllalealgdldddpvlvldgDrpllspelldrlleaakesgaavtv
00503871   1/1  gdlg.....irvvlqpgglgtagavllalealgdgddlvlvldgDrplvdpelldrlieaaaeggavvla
00388811   1/1  dlg.....ilivlvegglgtggsvllalealgdadpvlvldgDrplltpellerllealeehgalallav
00384621   1/1  ..ygvevvl.tredalgtgdavlealellgddpvlvlqgDvPlitpedldelleallesgadivvlvvev
00447431   1/1  k...lg..irivlvegglgtggsvllalealgelllldepflvllgDaarplvspelldrllealeedga
00466591   1/1  kklgievilriky.lqgdglgtadavllalkalgkdddpvlvllgDrplidpedidkliealkkngadav
00464661   1/1  ....glkviivlepeglgtadailaalkalgddpvlvllgDvplidpdlidklleal..kgadatvlvvp
00503661   1/1  ....dkvvvvvegglgradsvlnalealdddivlvhdgdrplvspelidrllealkeag..aailalpvk
00490571   1/1  vaekygaevvfrpaelagdgagtadsvlaalealedddivlvldadrpllspedidrllealresgadga
00526211   1/1  ----------------------------------------------------------------------
00485411   1/1  ----------------------------------------------------------------------
00513631   1/1  ----------------------------------------------------------------------
00446071   1/1  ----------------------------------------------------------------------
00393381   1/1  ----------------------------------------------------------------------
00496001   1/1  ----------------------------------------------------------------------
00531661   1/1  ----------------------------------------------------------------------
00472441   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKV
00468771   1/1  ptgygvveldedgrvlsfvEkpdeprsnlanaGiyvfspevldlleelkpsargelfltdvidlllaegl
00513641   1/1  idvdlselleahresgalatllvvpvpledptgyGvieldedgrvlsfvEkpdletaeeylalgllllls
00406931   1/1  vedpsgygvveldedgrvlrfvEkpdepgsnlanaGiyvfspevldlleellpsargelfltdvidylle
00473731   1/1  edptgygvvevdedgrvlefvekpdlpksnlantgiyvfnpgvlllllelllsalgeleltdilrallaa
00530951   1/1  likeylgdgsyfglkityvvqgkeplgtagalllaldflgddpflvlPdGnGDiltdldlsklldfhles
00441681   1/1  elleahresg..aavtvvpvpdpsgygvvvldegrvlsfvekp.dresllanagiyvfspelldllle..
00384271   1/1  edptgygvveldedgrvlsfvekpdlagsnlansGiyvfdaslldlleelapsafgeleltdvlyallek
00380051   1/1  vedpsgygvvvldedgrvlsfvekpdllaaqtpsnlantGiyvfdpelldallellpsdgargelyltdv
00481371   1/1  edptgygvvevdedgrvlsfvekpdlppsqlanaGiyvfrpdvldaleelapsalgeleltdiidlllee
00387431   1/1  vedptgygvvvlddgrvleivekpdllaeqtpsnlaniGiyvfspevldallelllkpgargeleltdll
00477071   1/1  dptgygvvvldedgrvlsfvekpd...snlanagiyvfspevfdllkelleellkpgargelyltdilaa
00501951   1/1  vpvpdpepltgygygvvvldedgrvlrfvekpdafraelllyllnsgifleatsdlanagiyvfspevle
00501781   1/1  vedpegygvpnvvkvvldedgrvlgfvekpipltaerlllrrqdlpvsylinggiyafrpelllalle..
00502661   1/1  .......ppgygtiklddgrvleivekpd....llanqgpylfdaellleal......rgelyltddlal
00503871   1/1  v......pvgygvvvvdedgrvveivekpd...lnlantgqyflspllldal...ekaargeleltdils
00388811   1/1  ....pvgdygvvvldedgrvleivekpd...lnlantGqyflspalldal...ealaggelyltdllsll
00384621   1/1  ddpillalpgygvvvldedgrvlyfvekpipyrrqdlapsylinggiyvfrpeillallellpgaleeie
00447431   1/1  avtlv......ppvygtikldedgrvveivekpd...lnlantGqyflsplllealea.....ggeiylt
00466591   1/1  vlvvpvkdpngygvvldkdglvlafvekpfpltrlqdlpksylanggiyifdasvllk............
00464661   1/1  vrdptgygvfkldllgkllsfvekpatdlasllalaglyvllvpg.........................
00503661   1/1  dtlkygditldrdglw.............aaqtpqlfrlellleal......egeyyltddasllealgl
00490571   1/1  ilvvpvsdtlkrgvvldedgrvlalvekplarartqdlfrlyllnggiyilk.dalde------------
00526211   1/1  ------------------------------------------------------------lelllegkll
00485411   1/1  -------------------------------------------------------------------lkl
00513631   1/1  -----------------------------------------------------------tsarilppavi
00446071   1/1  ----------------------------------------------------------------------
00393381   1/1  ----------------------------------------------------------------------
00496001   1/1  ----------------------------------------------------------------------
00531661   1/1  ----------------------------------------------------------------------
00472441   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RGYIVYGWWKDTGKPEDLLEANRKILMETTEELLGEMDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENC
00468771   1/1  lkvyaypldgywldvgtpedlleanalllsgla.................liglvliipesvigrgvvig
00513641   1/1  llllepksnlansGiyvfspevlldlleelap..ggelfltdilpallekglrvyaypldgywldvgtle
00406931   1/1  egllkvyaypfdgywldvgtpedlleanallll..llarlglyialleiialvlglipaklllllavdll
00473731   1/1  glkvyavlldgyewldvgtpedlleaeidlavrekrlglavvdpeivisdlgligalvlis..viggnvk
00530951   1/1  gadatlvvnvdnlvpvadpsryGvveldglgrvtkfveKpklp....angGiyvldpdvldlieylefsk
00441681   1/1  ...rgelyltdvlplllaag.kvyavpldgywldvg----------------------------------
00384271   1/1  glrvvavlgdgfawldvgtpedlle---------------------------------------------
00380051   1/1  islllaaglkvlaveldgywldvgtpe-------------------------------------------
00481371   1/1  glkvaavlgdgfewldvgtpedlleaealllsr.....lvrlgvllldpeniyirsgviigddlv.....
00387431   1/1  sllleaglkvlavlgdgfwldvgtpedllla---------------------------------------
00477071   1/1  llekglkvvavlldgywldvgtpedl--------------------------------------------
00501951   1/1  alenldidtledlelaeillall.kggkvy----------------------------------------
00501781   1/1  .gargeleltdvlellralaaggrv---------------------------------------------
00502661   1/1  lekaglkvavvegdgewldvgtped---------------------------------------------
00503871   1/1  lllelglkvvvvpgdgfwldvgtpe---------------------------------------------
00388811   1/1  eaaglrvlavegdgewldigtpedl---------------------------------------------
00384621   1/1  llealrlla.aggrvlayevdgewldvdtpedl-------------------------------------
00447431   1/1  dllslleaaglkvlavegdglwidv---------------------------------------------
00466591   1/1  ......lralengkkvavvlgdglwl--------------------------------------------
00464661   1/1  ..........lldllkdidtpe------------------------------------------------
00503661   1/1  kvalvegdeenikittpeDlalaea---------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00526211   1/1  flynlkgyaalvgllalavlvsldlldalglgllivknpylafarlllllgtnpllapgalihpnavieg
00485411   1/1  leyllqgewylvgtpelalealrlllllllllllglallihptalillgakigegvvigpgavigyggnv
00513631   1/1  ig.............dvligegvvigpgavi........nvvigdnvvigdgavieddvvigdnvligpg
00446071   1/1  ------------------------ipptalidlgakigegvvigpgavigg.....nvvigdgavigpgv
00393381   1/1  -----------------------------------vigpgaviggnvvigdgvvigpgvviggdivIGdn
00496001   1/1  --------------------------------------pgavigkgavigegtvimpavinagayigent
00531661   1/1  -----------------------------------mlggvvlidptavidggvvigegvvigpgaviggn
00472441   1/1  ------------------------------------------lalligptavidegvvigkdvvigpnvv


                         -         *         -         -         -         -         +:350
query           FIKNSYVGPYSSIGNRVILEDCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSQKRPASLNLILGNM
00468771   1/1  pgvvi..svildgvrigagvvledsiig------------------------------------------
00513641   1/1  s---------------------------------------------------------------------
00406931   1/1  ivgyglillglv----------------------------------------------------------
00473731   1/1  igygvv----------------------------------------------------------------
00530951   1/1  .......dliekllkkg.klyafning-------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00481371   1/1  ilvnvligngvglyllsl----------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00477071   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00466591   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00526211   1/1  navigenvvIgpnvvidnsvIgegvvIgdnvviensvigdnvrIgdnarildgavi--------------
00485411   1/1  vigdnvvigpgvvildvggvvIgdnvligpgvtig....hdshigdnvtigngve---------------
00513631   1/1  aviggnvvigdnvtIganavilnaiigkgvlIgdnvvigagavvlnddtvigd-----------------
00446071   1/1  virgdvglvvIGdnvvigdgvtihlhvghdsvigdgvtigngvvi.ggviIgd-----------------
00393381   1/1  vvigdgaviggdgfglpkaglrggviIgdnvtIgenv---------------------------------
00496001   1/1  iintgavighdavIGdnvh---------------------------------------------------
00531661   1/1  vviGdgvvigpgvvirgdivIGdnviigdgavigadgqdlkyagllggviI-------------------
00472441   1/1  iggnvligdnvvigpnvviggtiigdnvriksgaviggvgiglavrigpfarirg---------------


                         -         -         -         -         *         -         -:420
query           SRVEL-----------------------------------------------------------------
00468771   1/1  ----------------------------------------------------------------------
00513641   1/1  ----------------------------------------------------------------------
00406931   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00530951   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------
00384271   1/1  ----------------------------------------------------------------------
00380051   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00387431   1/1  ----------------------------------------------------------------------
00477071   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00502661   1/1  ----------------------------------------------------------------------
00503871   1/1  ----------------------------------------------------------------------
00388811   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00447431   1/1  ----------------------------------------------------------------------
00466591   1/1  ----------------------------------------------------------------------
00464661   1/1  ----------------------------------------------------------------------
00503661   1/1  ----------------------------------------------------------------------
00490571   1/1  ----------------------------------------------------------------------
00526211   1/1  ----------------------------------------------------------------------
00485411   1/1  ----------------------------------------------------------------------
00513631   1/1  ----------------------------------------------------------------------
00446071   1/1  ----------------------------------------------------------------------
00393381   1/1  ----------------------------------------------------------------------
00496001   1/1  ----------------------------------------------------------------------
00531661   1/1  ----------------------------------------------------------------------
00472441   1/1  ----------------------------------------------------------------------