[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD36465.1


[Show Plain Result]

## Summary of Sequence Search
   1::290
   1::236  2.2e-60 43.5% 0050281 00502811 1/1    domain                                 
   1::233  6.7e-58 43.1% 0038755 00387551 1/1    domain                                 
   1::235  5.7e-55 41.2% 0050323 00503231 1/1    domain                                 
 231::287  2.3e-15 50.9% 0050282 00502821 1/1    redox switch-like                      
 225::282  2.9e-14 50.0% 0050991 00509911 1/1    redox switch-like                      
 230::282  2.3e-12 54.7% 0050324 00503241 1/1    redox switch-like                      
   1::290


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
00502811   1/1  yllrflledgdvRgvlvrltelveealkrhdyppvvsallgealaaaallgallkfdgkltlqiqgdgpl
00387551   1/1  llvrflledgdvRgllvrltelveealerhdypplvsallgellaaaallaatlkfdgkltlqiqgdgpv
00503231   1/1  dDlllrflledgdvRgvlvrltelveealrrhdyppvvsallGealaaaallgallkfegrltlqiqgdg
00502821   1/1  ----------------------------------------------------------------------
00509911   1/1  ----------------------------------------------------------------------
00503241   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
00502811   1/1  gllvvdadsdgnvRgyvrnpevelplllagkldvaellgkGyLavtidlglgepYqGivplvsgelaedl
00387551   1/1  gllvveadadgtvRgyvrnpgvel.....gkldladlvgeGvlavtldlglgepYqGivplvsgelaedl
00503231   1/1  pvgllvveadadgevRgyvrnpgveledlalgkldvlaalggkGyLavtidlglgepYqGivplvsgela
00502821   1/1  ----------------------------------------------------------------------
00509911   1/1  ----------------------------------------------------------------------
00503241   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
00502811   1/1  eyYfaqSeQlptavllgvlvdedgvlaAgGlllQlLPgadeeeiweleellaetlsiselldeglsleel
00387551   1/1  eyYflqSeQlptavllgvlvddd.vlaAgGlllQlLPgadee..idllerllalldtisellllglslee
00503231   1/1  edleyYfaqSeQlptavllgvlvdedgdvlaAgGlllQlLPga.deelidllerllalldtvtdlellgl
00502821   1/1  ----------------------------------------------------------------------
00509911   1/1  ----------------------------------------------------------------------
00503241   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEEL
00502811   1/1  lyrlfheeev......vafgCsCsre--------------------------------------------
00387551   1/1  llyrlfgeedvkileplpvefgC-----------------------------------------------
00503231   1/1  sleelllrlfheedv......vrfr---------------------------------------------
00502821   1/1  --------------------CsCsrervldallslgkeeleelledgkievtCefCgkkylfdeeeleel
00509911   1/1  --------------qpvrfkCscsrervldaLlslgkeeleelleedgkievtCefCgkkYlfdeeelee
00503241   1/1  -------------------lCscsrervldaLlslgkeeledlleedgkievtCefCgkkYlfdeeelee


                         -         *         -         -         -         -         +:350
query           LKFKVDDSGS------------------------------------------------------------
00502811   1/1  ----------------------------------------------------------------------
00387551   1/1  ----------------------------------------------------------------------
00503231   1/1  ----------------------------------------------------------------------
00502821   1/1  leellkd---------------------------------------------------------------
00509911   1/1  ll--------------------------------------------------------------------
00503241   1/1  ll--------------------------------------------------------------------