[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD36720.1


[Show Plain Result]

## Summary of Sequence Search
   1::434
  67::338    1e-88 47.4% 0049963 00499631 1/1   oside phosphorylase/phosphoribosyltrans 
  68::330  1.1e-88 52.5% 0053310 00533101 1/1   oside phosphorylase/phosphoribosyltrans 
  71::329    3e-81 45.9% 0046005 00460051 1/1   oside phosphorylase/phosphoribosyltrans 
  71::317  5.5e-61 37.6% 0050093 00500931 1/1   oside phosphorylase/phosphoribosyltrans 
  75::326  3.3e-56 37.3% 0048481 00484811 1/1   oside phosphorylase/phosphoribosyltrans 
  73::314  6.7e-48 34.3% 0047803 00478031 1/1   oside phosphorylase/phosphoribosyltrans 
 331::435  4.8e-31 44.8% 0045474 00454741 1/1   idine nucleoside phosphorylase C-termin 
 331::434  3.4e-28 47.6% 0035686 00356861 1/1   idine nucleoside phosphorylase C-termin 
 331::433  3.2e-26 48.5% 0044472 00444721 1/1   idine nucleoside phosphorylase C-termin 
   1::70   5.9e-22 40.0% 0035684 00356841 1/1   oside phosphorylase/phosphoribosyltrans 
   1::70     2e-21 35.7% 0041663 00416631 1/1   oside phosphorylase/phosphoribosyltrans 
   1::69   2.6e-21 49.3% 0045472 00454721 1/1   oside phosphorylase/phosphoribosyltrans 
   1::67   6.2e-20 38.8% 0044470 00444701 1/1   oside phosphorylase/phosphoribosyltrans 
   2::70   5.3e-18 34.8% 0040083 00400831 1/1   oside phosphorylase/phosphoribosyltrans 
   4::68   1.1e-17 35.4% 0044665 00446651 1/1   oside phosphorylase/phosphoribosyltrans 
   1::434


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDEEETYYFTETMMRSGEVLD
00499631   1/1  ------------------------------------------------------------------elll
00533101   1/1  -------------------------------------------------------------------lll
00460051   1/1  ----------------------------------------------------------------------
00500931   1/1  ----------------------------------------------------------------------
00484811   1/1  ----------------------------------------------------------------------
00478031   1/1  ----------------------------------------------------------------------
00454741   1/1  ----------------------------------------------------------------------
00356861   1/1  ----------------------------------------------------------------------
00444721   1/1  ----------------------------------------------------------------------
00356841   1/1  mdlvellrklldgedLsreeaaalmdailsgevsdaqiaAflmAlrlkgetveEiagltramresaevld
00416631   1/1  mslvelleklldgkdLsreeaaalmdailsgevsdaqiaAflmalrvkgetveEiaglaramresaepld
00454721   1/1  lmdlvelirkkrdgedLseeeiealidgildgevsdaqiaAflmalrfkgetveEiagltramresgev-
00444701   1/1  lmdlvellrklrdgedLseeeaaalvdailsgevsdaqiaAflmAlrikgetveEiagltramresa---
00400831   1/1  -likelleklldgkdLsreeaaalmdailsgevsdaqiaAflmalrikgetveEiaglaramresaepld
00446651   1/1  ---vellrklldgedLsreeaaalmdailsgevsdaqiaaflmalrikgetveEiaglaramresaep--


                         -         -         *         -         -         -         -:140
query           LSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGTIDKLESIPGFRTELSLEEFI
00499631   1/1  lslldgpvvDkhgtGGdgfnislalapvvAaaGvkvakhggrglsskgGtaDvLealpGvnvdlspeevr
00533101   1/1  lllldgpvvDkhstGGvgdnvslalapvvAaaGvlvakhggRglsstgGtaDvLealpGvnvdlspeevl
00460051   1/1  lslldgpvvDkhgtGGdgfnistalapvvAaaGvpvakhggrglsstsGtaDvLealpGvnvdlspeevr
00500931   1/1  lslldglvvdivgtggdgkktfnisllaalvlaaaGvpVakhGnrglssksgsadvleal.Gvnlalspe
00484811   1/1  ----lgvlvdivgtgGdgrktfnistlaalvaaaGvpVakhGnrslssksgsadvleal.gvnldlspee
00478031   1/1  --lidlpvvdivgtGgdgsntfnistlaalvlAaaGvpVakhGnrsvsskrsgsadvleal.gvnldlsp
00454741   1/1  ----------------------------------------------------------------------
00356861   1/1  ----------------------------------------------------------------------
00444721   1/1  ----------------------------------------------------------------------
00356841   1/1  ----------------------------------------------------------------------
00416631   1/1  ----------------------------------------------------------------------
00454721   1/1  ----------------------------------------------------------------------
00444701   1/1  ----------------------------------------------------------------------
00400831   1/1  ----------------------------------------------------------------------
00446651   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLIASSIMSKKLAGGSDAFVLDVKFGTGAFMKG
00499631   1/1  elleevgiaflfapanlhPadkklyalrdvlgtvrtiflilgpllnpklaagadalvlGvkvgslafmkg
00533101   1/1  evveevgiailgapanlaPAdkllyalrdvtltvdtiflilapllspKlaagadalvldvkvgslafmkg
00460051   1/1  elleevgiaflfapallhPadkllyavrdetlgvrtifnilgpllnpKlaagadalvlgvkvgslaflla
00500931   1/1  eaaealeevgiaflfap.llhPalkrlialRdelglrtifntlgpLlnPagaplqvlGvfskklaellae
00484811   1/1  aaelleevgiaflfa.pllhpalkkllplRkelglrtifntlgpllnPagaplqllGvfhkklaellaev
00478031   1/1  eeaaealeevgiaflfa.pllhpalkklaplRkelglrtifntlgpllnPagaplqvlGvfhpklaella
00454741   1/1  ----------------------------------------------------------------------
00356861   1/1  ----------------------------------------------------------------------
00444721   1/1  ----------------------------------------------------------------------
00356841   1/1  ----------------------------------------------------------------------
00416631   1/1  ----------------------------------------------------------------------
00454721   1/1  ----------------------------------------------------------------------
00444701   1/1  ----------------------------------------------------------------------
00400831   1/1  ----------------------------------------------------------------------
00446651   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FEDAKKLAFLMLRIAQQHGKKAVAVLSNMDQPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALML
00499631   1/1  ldeasllartlvallkglglitealltpmdfplglaggnalevaealrvLlgggpgdlrdlvllnAaaaL
00533101   1/1  ldeasllaetlvavlkglglvtlalltdmdqplgrgignalevaealevLkgeegpedlrelvlllaaaa
00460051   1/1  lalarllakralvvggllgldeialltpedfglglavgnalevaealrvllgggpgdlrdlvlllAaaaL
00500931   1/1  vllllgvgralvvkggedeislagetvvielragltltpedfglsqallpllrggdpalnaeillavLkg
00484811   1/1  llllgvgralvvkglegldeislagttlvaelrdgeiteyvltpedfglgrallealeggdaeenaeill
00478031   1/1  eallllgvgralvvkg.egldeislagttlvaelrdgeiteylltpedfglgrallealeggdaeenaei
00454741   1/1  ----------------------------------------------------------------------
00356861   1/1  ----------------------------------------------------------------------
00444721   1/1  ----------------------------------------------------------------------
00356841   1/1  ----------------------------------------------------------------------
00416631   1/1  ----------------------------------------------------------------------
00454721   1/1  ----------------------------------------------------------------------
00444701   1/1  ----------------------------------------------------------------------
00400831   1/1  ----------------------------------------------------------------------
00446651   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ELAGVADFEEGKKILQEKLETGEALDKFRLLVKAQGGNERVVDDPWRVLPVAEQVVEFSAAREGFVSKID
00499631   1/1  vlagladsleegvelalealdsGkAlekleelveaqggdldvvedllllleaalllll------------
00533101   1/1  LvlaglaedleegvelaaealdsGkAlekleelvaaqggdldlledllll--------------------
00460051   1/1  vlagladdleegvelarealdsGkAlekleelveaqgglldvledllll---------------------
00500931   1/1  egpgplrdavllnaaaalvlagladdleeglelarea---------------------------------
00484811   1/1  avLsge.pgalrdavllnaaaaLvlagkasdleegvelarealdsg------------------------
00478031   1/1  llavLsgegpgalrdavllnaaaaLylagladle------------------------------------
00454741   1/1  --------------------------------------------------qaklvlevlaeesGyvseid
00356861   1/1  --------------------------------------------------laklvlevlAerdGyvsaid
00444721   1/1  --------------------------------------------------laklvlevlAersGyvsaid
00356841   1/1  ----------------------------------------------------------------------
00416631   1/1  ----------------------------------------------------------------------
00454721   1/1  ----------------------------------------------------------------------
00444701   1/1  ----------------------------------------------------------------------
00400831   1/1  ----------------------------------------------------------------------
00446651   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AEKVGIASMMLGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISD
00499631   1/1  ----------------------------------------------------------------------
00533101   1/1  ----------------------------------------------------------------------
00460051   1/1  ----------------------------------------------------------------------
00500931   1/1  ----------------------------------------------------------------------
00484811   1/1  ----------------------------------------------------------------------
00478031   1/1  ----------------------------------------------------------------------
00454741   1/1  aralGlaavllGaGRarkedeidlavGlvlllklGdrvekgeplatihandeadleealealkkaieisd
00356861   1/1  alalglaavllGaGrakkedkidlsaGlvllkklGdlvkkgeplltlyandeaelelale.llkailisd
00444721   1/1  alalglaavllGaGR..kedpidlavGlvllvklGdrvekgeplatlyandeaeleaalellleaieisd
00356841   1/1  ----------------------------------------------------------------------
00416631   1/1  ----------------------------------------------------------------------
00454721   1/1  ----------------------------------------------------------------------
00444701   1/1  ----------------------------------------------------------------------
00400831   1/1  ----------------------------------------------------------------------
00446651   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SPSEPPRVVEEVIK--------------------------------------------------------
00499631   1/1  ----------------------------------------------------------------------
00533101   1/1  ----------------------------------------------------------------------
00460051   1/1  ----------------------------------------------------------------------
00500931   1/1  ----------------------------------------------------------------------
00484811   1/1  ----------------------------------------------------------------------
00478031   1/1  ----------------------------------------------------------------------
00454741   1/1  eapeetplilelite-------------------------------------------------------
00356861   1/1  eapevtplilerir--------------------------------------------------------
00444721   1/1  eaveatplileli---------------------------------------------------------
00356841   1/1  ----------------------------------------------------------------------
00416631   1/1  ----------------------------------------------------------------------
00454721   1/1  ----------------------------------------------------------------------
00444701   1/1  ----------------------------------------------------------------------
00400831   1/1  ----------------------------------------------------------------------
00446651   1/1  ----------------------------------------------------------------------