[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD36835.1


[Show Plain Result]

## Summary of Sequence Search
   1::497
   2::167  1.4e-36 36.9% 0044458 00444581 1/1   bacter dihydroxyacetone kinase extra AT 
   1::497


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILRGMADASPREY
00444581   1/1  -fpvGDGDtGinmargaeavlealddlkleladlaellkaialallsgagGtsGvlygilflglakalkg


                         -         -         *         -         -         -         -:140
query           ITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEELFDWIVEIARDTVNRTPHML
00444581   1/1  k....edlaeallaaleavykrgkakpgdkTlldvlvpaveal.....ldllelleaaveaaeegaesTa


                         +         -         -         -         -         *         -:210
query           QKLREAGVVDAGAKGLYYIFEGMRDAVKGNIQVNLEEVEQASVEELQRMAFEEITNRYCTEVAVRRNQVV
00444581   1/1  kdllaklGRAsylgersllgvvDpGAv-------------------------------------------


                         -         -         -         +         -         -         -:280
query           EKSELEAFLNEIGDSVVLVEQDDLIKLHVHTNHPGQVLEKVIEFGEIVKVKIDNMKLQHEHVISTQPTKE
00444581   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IGVVAVSPGKGISDILKSLGVDVIVPGGQTMNPSFADLKAAVEQTHAKNVFLFPNNANVLLTAKQIAEAF
00444581   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DDRRVIVVPTSFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF
00444581   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDLEIYEGGQPHY
00444581   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PYLMLLQ---------------------------------------------------------------
00444581   1/1  ----------------------------------------------------------------------