[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tmar0:AAD36879.1


[Show Plain Result]

## Summary of Sequence Search
   1::124
   1::124  6.4e-42 42.7% 0049530 00495301 1/1   genase accessory factor-like            
   1::123  1.6e-32 34.4% 0037104 00371041 1/1   genase accessory factor-like            
   1::118  2.7e-32 41.7% 0049148 00491481 1/1   genase accessory factor-like            
   1::119  3.9e-22 28.1% 0048713 00487131 1/1   genase accessory factor-like            
   1::124


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIV
00495301   1/1  MkiAipssdgkgldslvsghFgrApyFliydvedgeielvenlenplaggggggalaelllelgvdvviv
00371041   1/1  mkiAvaskdg.gldslvdqhFGrApyFliydveggeiklvevrenpaleagggagklaaellalegvdav
00491481   1/1  lmkiAvpskgg.gldslvsehFgrApyFliydvedgevklvenrenp..ggggggalaelllelgvdvvi
00487131   1/1  eleleglmkiAvaskdgvl....vdqhFGhAerFliyevddggvklvevrelp.kygggedklaarleal


                         -         -         *         -         -         -         -:140
query           RGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHHHEHH----------------
00495301   1/1  ggiGegalaaLlaagikvyvgaegtveealeallagelteltagcasgghgggg----------------
00371041   1/1  lvggiGpgalekLleagikvyvaaegtveealeallaglleeltaalagaghg-----------------
00491481   1/1  vggiGpgaleaLeaagikvyvgaegtveealeallageleeltallae----------------------
00487131   1/1  sdvdvvlvggiGggaaarLvaagievikvaegetieealeallegllgs---------------------