[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80359.1


[Show Plain Result]

## Summary of Sequence Search
   1::417
  48::325  PF01547 0.0% 30.4511278195489  Bacterial extracellular solute-binding protein 
   1::417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKALLLVAALGVAFAQQAKPEDVIKEQCARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPV
PF01547         -----------------------------------------------gaalqalvakafekehpgikVei


                         -         -         *         -         -         -         -:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
PF01547         esv.gsgslaqkltlaiaaGdgpaDviavdndwiarlakaglllpldpyvdaylapgvkdaadklsssvl


                         +         -         -         -         -         *         -:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
PF01547         pkilds.kv...ly.vPly.aargliYNkdlfekagldppwtWdelveaakklkekgkkpiggarggsas


                         -         -         -         +         -         -         -:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
PF01547         gtayyfalalakslggkvfdkdgg.ldnpegvtaatylvklyavanltkelkgkgaenkdgaaalalfea


                         -         *         -         -         -         -         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYA
PF01547         GeaamaivglwaalaamkvapkvafaadkekpkeelgvaplPagk-------------------------


                         -         -         -         -         *         -         -:420
query           AENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSRTR---
PF01547         ----------------------------------------------------------------------