[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80360.1


[Show Plain Result]

## Summary of Sequence Search
   1::620
 220::612  PF01314 0.0% 43.75  Aldehyde ferredoxin oxidoreductase, domains 2 & 3 
   5::206  PF02730 0.0% 51.7412935323383  Aldehyde ferredoxin oxidoreductase, N-terminal doma 
   1::620


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKGYHDRVAFVDLSTGKVWYESFGEAFWRRYLGGRALAAYLLLRHVPKGADPLGPENALVFAPGILTGT
PF01314         ----------------------------------------------------------------------
PF02730         ----yagkilrvdLskgkvkveeleeelakkylGgrglgakllldevdpevdplspenklvfatGpltGt


                         -         -         *         -         -         -         -:140
query           PISGSGRNTVAAKSPLTGGYGDAEGGGFFGAELKNAGLDALVVLGQAEAPVYLHVEGGKVALHPAVHLWG
PF01314         ----------------------------------------------------------------------
PF02730         aapssgrlavvtkSPltgtiaesnaGgafgaeLkkagyDaivieGkaekpvylvieddkveirdaselwG


                         +         -         -         -         -         *         -:210
query           KDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARAHKETL
PF01314         ----------------------------------------------------------------------
PF02730         kdvyettkalkeel.eevsvavIGpAGenlvrfAaivndkgraagrgGlGaVmgsKnlkaivvkgt----


                         -         -         -         +         -         -         -:280
query           PAYHDPGLLKELARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALG
PF01314         ---------keaqkviksspvtk.kalkkyGtaalvnisnelgalptrnfqrgrfeeaekisgealaeey
PF02730         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRIGRDTCYACAIRCKQVVKIEGTGKYDVRPEYGGPEYEGLGALGSTCGVTDPYAVTKANTLCNQYGLDV
PF01314         l.vrkrgCysCpiaCgrlvkve..gky.....eegpeyetiaalGsnlgiddleavlklnrlcnelGlDt
PF02730         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIEKLARREGRLGELLAQGAKRLAESLGHPELAM
PF01314         istGntiafamelyekgllkeedtdglelefGdaeallellekiakreG.igdllAeGvkrlaeklggee
PF02730         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPLPIEDLSEAKI
PF01314         lamhvkglelpaydprgakgmalayatsnrGacHlra...ytiakeil........gekldplet....e
PF02730         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEE
PF01314         gkaklvkwfedltavidslglCkftsflaldledyakllsavtGieiteeelleaGeRiynleRlfnvre
PF02730         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEGGVDPERLRALGLEEFQNALA----------
PF01314         glrrkddtlPerlleeplkegpakgkldreeleemldeYYelrGWdeeGvPt------------------
PF02730         ----------------------------------------------------------------------