[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80391.1


[Show Plain Result]

## Summary of Sequence Search
   1::397
  50::386  PF00155 0.0% 25.2307692307692  Aminotransferase class I and II 
   1::397


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQY
PF00155         -------------------------------------------------pevakaeke.galaggtlney


                         -         -         *         -         -         -         -:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
PF00155         gpidglpeleealakflgrseklklkreaavvvgsGagaliealifllklnpgdeilvpdptyasyknil


                         +         -         -         -         -         *         -:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
PF00155         rlsggevvryplyseedfhldlealeealkeapegnkktkvvlvesphNPtGtvatleeleklldlakky


                         -         -         -         +         -         -         -:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
PF00155         nlllfvDeaYagfvfgsldavat..ranveeepnllivgslsKafGlaGeRvGyilgnaavvsqlrklsr


                         -         *         -         -         -         -         +:350
query           LLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
PF00155         pfls.ssllqaavaaalsdallkqseleemrqrlqkrrkelrdeLael...glkvlasqsgmflltdlsa


                         -         -         -         -         *         -         -:420
query           FVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLALV-----------------------
PF00155         e.takelskkLleevgvyvtpgtsftv....pgrlR----------------------------------