[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80413.1


[Show Plain Result]

## Summary of Sequence Search
   1::76
  23::59   PF08672 0.0% 40.5405405405405  Anaphase promoting complex (APC) subunit 2 
   1::76


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRKGWVMRAVEALRLATFKEIQRYLDEEGEPFSKKELLDTLKALVAEGLLEEKEGVYRPARKKGSAEAF
PF08672         ----------------------LkmfpkdkegytvsqeeLeefLdklVeegkLevvggs-----------


                         -         -         *         -         -         -         -:140
query           RRLFGD----------------------------------------------------------------
PF08672         ----------------------------------------------------------------------