[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80551.1


[Show Plain Result]

## Summary of Sequence Search
   1::136
  42::128  PF00011 0.0% 26.4367816091954  Hsp20/alpha crystallin family 
   1::136


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLERHDRLETLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
PF00011         -----------------------------------------ikeekdkfevkldvpglkkeelkvkvedn


                         -         -         *         -         -         -         -:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPATALPLKEA----
PF00011         kvlvkgeheeeeeddkglrserssrkFsrkftLPenvdkdkvkaslkdGvLtvtvpkk------------