[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80557.1


[Show Plain Result]

## Summary of Sequence Search
   1::566
   1::566


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRALLHLLLFLALLPSLLALAPRLRAQAPGPVALVLDAEAVREEARARGEDLMAALARYQAFGVNGVAFP


                         -         -         *         -         -         -         -:140
query           ERLVRDWVGEGVLLYRQGRELVEMGLSARPGWHYLKGDPALLALLERAYDLPSERLGEWLGFPVDVQALP


                         +         -         -         -         -         *         -:210
query           AFYNLEELRQAKAMGLYVMVRPLNHRLRRLEAGLPLVPKEADAVVFQGLEALGYPYRLGEAKALVPVPVA


                         -         -         -         +         -         -         -:280
query           LIEGTPQAGLGAFRDKGILRLFSLRYEWLLTLKPEEAAEKYGLAARERSHQILYLRPYPYPEDTARLLKR


                         -         *         -         -         -         -         +:350
query           LQEELKASGLPLGAPSPRALAPSPLRYAAWVGVLAGLGLLALGLPVYGPLVAFLLLLFALGYAGSQAGPL


                         -         -         -         -         *         -         -:420
query           LAALVFPVLGFLGPRNGLWMWARSLGYALLGAVFLSALGSTEEAIAGLAPFKGVSLTLLVPPLLVAYSFL


                         -         -         +         -         -         -         -:490
query           EKDFKEALTRLFLHPARLGEVALGGLALGLLLLALLRRGNDAPIVPELELKLRALLQDVMVRPRFKEVFG


                         *         -         -         -         -         +         -:560
query           HALFPLALLLPWPRWVQNGLLFLASLGIASILNTFSHYHTPLPISFFRVLNGALLGLSLGLVGVILVRRL


                         -         -         -         *         -         -         -:630
query           RAWWSA----------------------------------------------------------------