[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80636.1


[Show Plain Result]

## Summary of Sequence Search
   1::443
  22::197  PF03721 0.0% 40.5714285714286  UDP-glucose/GDP-mannose dehydrogenase family, NAD b 
 217::310  PF00984 0.0% 35.8695652173913  UDP-glucose/GDP-mannose dehydrogenase family, centr 
 335::428  PF03720 0.0% 37.2340425531915  UDP-glucose/GDP-mannose dehydrogenase family, UDP b 
  22::149  PF03446 0.0% 30  NAD binding domain of 6-phosphogluconate dehydrogen 
   1::443


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTASETHLQALKEKITNRTAIVGVVGLGYVGLPFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPT
PF03721         ---------------------iaviGlGYvGlptavvlaekghevvgvDineekvdklnsgkipiyEpgl
PF00984         ----------------------------------------------------------------------
PF03720         ----------------------------------------------------------------------
PF03446         ---------------------igfiGlGvMGsnmarnllkagykvavydrtkekveelvaeg........


                         -         -         *         -         -         -         -:140
query           EVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTY
PF03721         eellkknveegrlrfttdvkeavkeadvifiavgTpskkgkaaDlkyvesaaeeiaevlkkgkvvvvkST
PF00984         ----------------------------------------------------------------------
PF03720         ----------------------------------------------------------------------
PF03446         ...........aeaaesieefvasldvvilmvpag.........kavdeviegekgllealekgdilidg


                         +         -         -         -         -         *         -:210
query           PGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKV
PF03721         vpvgtteelvkeilekaskkk.vdfdvvsnPEflreGkalkdllnpdrvviGveeek-------------
PF00984         ----------------------------------------------------------------------
PF03720         ----------------------------------------------------------------------
PF03446         stispedtr-------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VPVSSAKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIP
PF03721         ----------------------------------------------------------------------
PF00984         ------ktAEliKlaaNaflatkisfiNelaniaeavgadveevaeavgldprigkkflkpgigfGGscl
PF03720         ----------------------------------------------------------------------
PF03446         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IDPHYLEWKAKEYNFNTHFIALAGEINRKMPEFTVEKALRVLAEAGVPVRGAKVLVLGVAYKRDIPDYRE
PF03721         ----------------------------------------------------------------------
PF00984         pkDvlalvkkaeelgleak..lleavvnsn----------------------------------------
PF03720         ------------------------------------------------------avlGlaFKkntdDlRe
PF03446         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SPAIEVIRGLRRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR
PF03721         ----------------------------------------------------------------------
PF00984         ----------------------------------------------------------------------
PF03720         SpaldiieeLleegaevkiyDPkvkeeaaealleeknvelvsdleealkgadaiviltehdefkeldlek
PF03446         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VLDARGATRHLPRELTEGKVVLL-----------------------------------------------
PF03721         ----------------------------------------------------------------------
PF00984         ----------------------------------------------------------------------
PF03720         lkelmkkp--------------------------------------------------------------
PF03446         ----------------------------------------------------------------------