[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80650.1


[Show Plain Result]

## Summary of Sequence Search
   1::399
   9::335  PF07690 0.0% 37.7300613496933  Major Facilitator Superfamily 
 200::376  PF07690 0.0% 33.1360946745562  Major Facilitator Superfamily 
 246::365  PF03209 0.0% 34.1666666666667  PUCC protein 
   1::399


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRRLLALLSGVLLGTVSESSLAPALPVLERAFAVGPEAAQGVVSLGLLGAALAYLPLAGLAGRVGAGRL
PF07690         --------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrr
PF07690         --------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrr
PF03209         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FRTGLFLHALSALLLALAPSLLALYLLRLLQGVATAMVVGLVPGLAASAFPEARGYALGMVASTVAAGTL
PF07690         vlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfsl
PF07690         vlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfsl
PF03209         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGPALGGLAAGWGLPYVFLLPLPAALLALLLSGNLPELPRQEGTLPGLLRAPGFLPALLATGLYFLHALG
PF07690         GailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkeaaflaalarsi
PF07690         GailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkeaaflaalarsi
PF03209         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTVALAFHLGKEGFSPGAIGGLLLLGPLELLFLGAWAGRRADRMGYNRVALLGAYLLVAAGLAFALLPLL
PF07690         lgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalg.lllllfa.
PF07690         lgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvlllglllfalg.lllllfa.
PF03209         -----------------------------------laglvlsrgldklrlaglgvlvgllaflllilaal


                         -         *         -         -         -         -         +:350
query           HPLWGSALALLLLGVGRALFQAANNALVLSLAPKGTEGLASGALSVARALGQALGSALAGGSLGLFYRLF
PF07690         .sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailgpllggllasslg.
PF07690         .sslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailgpllggllasslg.
PF03209         lenkallvlgvlliGlgaGlfavaaltamldlaaeeqaglalGaWGaaQaiaaglaillggvlrdlvkal


                         -         -         -         -         *         -         -:420
query           PSHGLAFAATALLLTALMGLAAFLVRGREGSGEEVGHAPLDDPGGEGGA---------------------
PF07690         .WravFlilailsllaav...lvlll--------------------------------------------
PF07690         .WravFlilailsllaav...lvlll--------------------------------------------
PF03209         aandaalayslvfal-------------------------------------------------------