[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80675.1


[Show Plain Result]

## Summary of Sequence Search
   1::369
  90::365  PF00528 0.0% 22.5988700564972  Binding-protein-dependent transport system inner me 
   1::369


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRDRILAFLVLLPSVLAVGVFVYGFIGQNLWVSLTDWGKDPAQALALRPELRFVGLENYRELFTGFVDVR
PF00528         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FRQSVVNLIFFTLFFMAGSLGLGLLLALAVDKAPRGEGFFRTVFLFPMALSFVVTGTIWRWLLQPQGGVN
PF00528         -------------------illGilaa..lnrnkkldkllrpliivlsslPsfvlaillvlvf.......


                         +         -         -         -         -         *         -:210
query           VLPTLFGLPPLSFPWLATREQVLVFDWNRLPFYTALVVGLVLLYVAYTAYREGERRRALWGLASAGVLLL
PF00528         ......................................................................


                         -         -         -         +         -         -         -:280
query           WAFAFGQGLRLLPYPEVHGFSLALVGVILAAVWQMSGYTMALYLAGLRGIPVEVLEAARVDGASEWQLFR
PF00528         ..............vilsilghlilpviillllsaapyvrlirraalrslpkdlveaaralGasrwqifr


                         -         *         -         -         -         -         +:350
query           RVIFPMLAPITLSAMIVLGHIALKIFDLVFAMAGLDYAPTDVPAIYMYLLAFRGNQFAKGAAIGILLLLL
PF00528         kvvlPnalppiitglilafggllggavlleflgswpGlgtllleailgydyseis......nggvlalvi


                         -         -         -         -         *         -         -:420
query           VAVVVVPYLATQLRKEVRR---------------------------------------------------
PF00528         avlllnlvadilqrl-------------------------------------------------------