[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80689.1


[Show Plain Result]

## Summary of Sequence Search
   1::257
  38::248  PF00561 0.0% 24.8803827751196  alpha/beta hydrolase fold 
  77::111  PF02230 0.0% 28.5714285714286  Phospholipase/Carboxylesterase 
 193::228  PF02230 0.0% 38.8888888888889  Phospholipase/Carboxylesterase 
   1::257


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPPRAHAEDLLAL
PF00561         -------------------------------------fdviglDlrGvgySspaggpelphyttddlakd
PF02230         ----------------------------------------------------------------------
PF02230         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LDEAKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRAKVESWLHALKTGGTVLRLRV
PF00561         leavldalglkkltlvGhSmGGmialayaaeypdrvkamvllgtvasvlsdglssdvlnr.g.stltlla
PF02230         ------sriilgGFSQGaalalylaltspkklagiialsga-----------------------------
PF02230         ------sriilgGFSQGaalalylaltspkklagiialsga-----------------------------


                         +         -         -         -         -         *         -:210
query           ALPWVFGRGFLEAHPELLAEEGLRGLAAQAPTKTAQERLLLGFLTLEDLRPRLKALALPALVLYGTEDLL
PF00561         dnvagrlskgikplqgdasvqaqsllrpqvtdflkrfdansyiregetraldgkllaalgrdlvwdvtet
PF02230         ----------------------------------------------------atalakvpilllHGeeDp
PF02230         ----------------------------------------------------atalakvpilllHGeeDp


                         -         -         -         +         -         -         -:280
query           FPKAYASNLAEALRARLEALPAGHAAPIEAPLAFARAVRAFLEEVYA-----------------------
PF00561         lstilvptlvisgtdDplvpykaseklaelipksqlvv--------------------------------
PF02230         vvplalgkaakellkkll----------------------------------------------------
PF02230         vvplalgkaakellkkll----------------------------------------------------