[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80708.1


[Show Plain Result]

## Summary of Sequence Search
   1::421
  20::176  PF00587 0.0% 26.4516129032258  tRNA synthetase class II core domain (G, H, P, S an 
 331::417  PF03129 0.0% 39.0804597701149  Anticodon binding domain 
   1::421


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
PF00587         -------------------knniiqawreefieeegflevdtPiltpeevlka.sGhvdkfade.mykvk
PF03129         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
PF00587         dtgeeelyLrPetaqgiflnfkkllesnyrklPfklaqigkvfRnEisprsGllRvReFtqaeieifvdp
PF03129         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKS
PF00587         ekseeeleellalikefleklgleklrfrqstrgel----------------------------------
PF03129         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
PF00587         ----------------------------------------------------------------------
PF03129         --------------------------------------------------vvviplgekaeeledyakkl


                         -         -         -         -         *         -         -:420
query           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
PF00587         ----------------------------------------------------------------------
PF03129         aeeLreagirvelddrsesigkklrradllgipfavvvGekelekgtvtvrdrdtgekervsleelv---


                         -         -         +         -         -         -         -:490
query           G---------------------------------------------------------------------
PF00587         ----------------------------------------------------------------------
PF03129         ----------------------------------------------------------------------