[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80739.1


[Show Plain Result]

## Summary of Sequence Search
   1::342
  21::337  PF01032 0.0% 50.1639344262295  FecCD transport family 
 128::304  PF00950 0.0% 27.4853801169591  ABC 3 transport family 
   1::342


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRALPPALARGLVFLWLVALLLGAVALGVGLGAVAVPPEAVVRALLGLEENPIVTELRLPRVLAGVLVG
PF01032         --------------------llllllllslllgavkislsdvfeallgkdssleesivlelrlprilaal
PF00950         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AALGVSGAAFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFVGAL
PF01032         lvGaaLavaGallQtvtrNpLadPsilGissgaalgavlalllf............lslsllalplaafl
PF00950         ---------------------------------------------------------llgailvgliaav


                         +         -         -         -         -         *         -:210
query           SATLLTLVLAGGVARTGELVLAGVVVGSVLTGLTTYLMMQDADRVRAVFAYTLGNLAFAGWEGVRVLALF
PF01032         gallaallvlllskkrggasplrliLaGiavsallsaltslllllaneealasilfwllGslsgaswsev
PF00950         aiellk.....rksklkedtaiGivlssfl.alglllislikkskvdldsyLfGniltiseedliliaii


                         -         -         -         +         -         -         -:280
query           FALAFPPLLFLGRVLNALGLGEETARSLGLPLEALKLLLLGAASLLTASAVAQAGIIGFVGLVTPHLLRR
PF01032         llllpllllglllllllarklnllalgdetAkslGvnvkrlrllllllaalltavavalvGpIgFvGLvv
PF00950         eavvllllllfykelllitfdeelAkveglsvkllkllllilialtvvvalqavGviLvialliiPaatA


                         -         *         -         -         -         -         +:350
query           LLGEDYRLLLPASALGGGALLALADLLARTLARPAELPVGVVTTLLGGPFFLYLMWRRRGRA--------
PF01032         PhiarllvgarhrkllplsaliGallllladllarlllaptelpvGivtaliGapff-------------
PF00950         rllakslesllllaillglvsvvl----------------------------------------------