[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80786.1


[Show Plain Result]

## Summary of Sequence Search
   1::177
  12::166  PF04079 0.0% 52.258064516129  Putative transcriptional regulators (Ypuh-like) 
   1::177


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERVAGGWRLVVHP
PF04079         -----------EAiLfvageplsleelaeileseeeveealeeLkeeyeeedrglelvevaggyrlqtkp


                         -         -         *         -         -         -         -:140
query           KALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPG
PF04079         elaelvkklvkekketrLsqaaletLaiIaykqpvtraeieeirGvnsdsvvktLlergLikekgrkeep


                         +         -         -         -         -         *         -:210
query           RPKLYGTTERFLEVFGLESLEDLPPLREDGPPLLLRG---------------------------------
PF04079         grpilYgtTekFleyfglksleeLpk--------------------------------------------