[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80787.1


[Show Plain Result]

## Summary of Sequence Search
   1::195
  15::183  PF01300 0.0% 42.2619047619048  yrdC domain 
   1::195


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MERVYQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
PF01300         --------------alkkGkivaiptetvYgLacdatneeaverlreiKqrpkdkplavlvssledlekl


                         -         -         *         -         -         -         -:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKS
PF01300         ae.seveeealklaerfwPgpitlllkaskeklpklvapglktvGvrlPdhplarlLlealgeplvaTSa


                         +         -         -         -         -         *         -:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGAIPKEALLAHLR---------------
PF01300         nlsgepsltdaeeveeelgekvdlildggeiavgvdstVvdlt---------------------------