[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80819.1


[Show Plain Result]

## Summary of Sequence Search
   1::211
  49::197  PF01323 0.0% 27.972027972028  DSBA-like thioredoxin domain 
   1::211


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPR
PF01323         ------------------------------------------------vdeffDvlCPyCy.lgkerlek


                         -         -         *         -         -         -         -:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
PF01323         laars...pdvkvvlrpfelagakkasgnvgpselpeklkylledlkrlaeaegiplrfpkdklknstra


                         +         -         -         -         -         *         -:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKA
PF01323         arlllaagaeglaekvvrelfealwsegqaitddqe..llevaekaGldaeeldeal-------------


                         -         -         -         +         -         -         -:280
query           E---------------------------------------------------------------------
PF01323         ----------------------------------------------------------------------