[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80853.1


[Show Plain Result]

## Summary of Sequence Search
   1::274
   7::273  PF01148 0.0% 35.6589147286822  Cytidylyltransferase family 
 174::271  PF01864 0.0% 36.5591397849462  Putative integral membrane protein DUF46 
   1::274


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDHLPTRVFSALAGALLLLLVLWGGIPLILPTLLFVHWLGTRELAEMLARRGIALNTPLLLAGGVLVFL
PF01148         ------kRkilhivlilivlillllgklillllvaivvilalkelirllrakfrskkllltrllslifll
PF01864         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FSLPQLYWHFPQVPWREVALGLFLLASFSYELLFGANLPRFAFGLMAFLYLPWSLGYVLLLRETPDAAMG
PF01148         lalllvylesllallklvlllvlvllllvlk...slklhrviltllyllyvvlfl....slllianileg
PF01864         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LWTLTLPLVASFATDIGAYFIGRAFGRRKLAPEISPGKTVEGSLGGIAVSFLALVVYTGLVREVFPFGLL
PF01148         livalllilvvwanDifAylvGkafGkt.llpkispkKTveGflggfvaavlvgllfslvlskrl.lsll
PF01864         ---------------------------------lGdGktwrGfvaGvlvGvlvgiiqyllvklsilalef


                         -         -         -         +         -         -         -:280
query           ELWLFSLLLSLGAQLGDLAESMLKRFAGVKDSGNFLPGHGGLLDRIDSLLFAFPLTYFLVVLFT------
PF01148         hllllsllaslvavfgdlfesglKRafgiKDsGkliPGhGgilDrldslllaapflyillklf-------
PF01864         sgslleavilafllslGalvGdlvGsfikrrlnier.Gkpal....ildqldfllaallla---------