[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80854.1


[Show Plain Result]

## Summary of Sequence Search
   1::185
  21::184  PF01765 0.0% 57.9268292682927  Ribosome recycling factor 
   1::185


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQS
PF01765         --------------------lkkelkkirtgranpslldkikVeyygektpLnqvAsisvkeartllitp


                         -         -         *         -         -         -         -:140
query           WDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRREALDKL
PF01765         fdkslikaiekaIlasdlglnpqndgqviripiPplTeerRkelvkeakklaEeakvairniRrdankkl


                         +         -         -         -         -         *         -:210
query           KKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEILG-------------------------
PF01765         kklekekeiseDeekkaekeiqkltdkyikkidellkkkekelm--------------------------