[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80903.1


[Show Plain Result]

## Summary of Sequence Search
   1::370
 105::368  PF01875 0.0% 32.6923076923077  Memo-like protein 
   1::370


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEGRLRLREPQITPIEGGFLVSDPYGVYEKPLALTEGGLFLLSLMEGRTLEEVQEEVFKRHGVLVPKKEL
PF01875         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EDLAKALEEAGLLLTEKVEARLKEEEEKLKRERPMRLAGLSYPEGEREARAFLEAFRASYPGEGEEARVL
PF01875         ----------------------------------pavAGsfYpedeeelkkqleelllknlgeke.arvi


                         +         -         -         -         -         *         -:210
query           LMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGPALPDLPALQALDA
PF01875         ivPHagyvysgevaaksykalek.skvervvilGpsHtglgskvavlaaseleTPlGdvkvDeelveelv


                         -         -         -         +         -         -         -:280
query           LLPFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSH
PF01875         kkseiadldelah.kaEHSlEvqlpflkellkeakkvkivPilvsaqdeevakelgealaevikdesnlv


                         -         *         -         -         -         -         +:350
query           VGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLA
PF01875         iaSsDfsHygrrfglshspeeiaesirnlDrevikaieeldedelkeyleetnnt.icGekpiavilkal


                         -         -         -         -         *         -         -:420
query           HRLDLEAPTLSAVGAGTLVL--------------------------------------------------
PF01875         kklgakkakllkYatssd----------------------------------------------------