[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80912.1


[Show Plain Result]

## Summary of Sequence Search
   1::427
  41::365  PF00202 0.0% 37.3801916932907  Aminotransferase class-III 
 187::423  PF00155 0.0% 24.537037037037  Aminotransferase class I and II 
   1::427


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
PF00202         ----------------------------------------itkakGvyltdvdGrrylDflsgiavvnlG
PF00155         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTNRPYI
PF00202         hahpkiveavkeqadklshvsfralttepalklaeklaeltPkgldkvflansGseanetAlKlarayek
PF00155         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLRRRGEEIAAIIFEP
PF00202         kkgatektkiiafegafhGrtlgalsvtkskkykklfgpllpgv........eilpypdlkaaeeekall
PF00155         ----------------------------------------------ldlealeealkeapegnkktkvvl


                         -         -         -         +         -         -         -:280
query           VVGNAGVLVPTEDFLKALHEAREFGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKVLGGGLPAAAY
PF00202         eeaerlikevkkeeiaAvivEPiqgegGvvvaseeflaklreickkhnvllivDEvqtGfGrtGklfAae
PF00155         vesphNPtGtvatleeleklldlakkynlllfvDeaYagfvfgsldavatranveeepnllivgslsKaf


                         -         *         -         -         -         -         +:350
query           AGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEENPGYYRYLEDLGARLERGLKEVLAQKGIP
PF00202         hagvepDlmtlaKaltgGlplsavlataevmqafqpgs...hgttfggnplacavalavlevieee.ell
PF00155         ..GlaGeRvGyilgnaavvsqlrklsrpfls.ssllqaavaaalsdallkqseleemrqrlqkrrkelrd


                         -         -         -         -         *         -         -:420
query           HAVNRVGSMVTVFFTEGPVVTFQDAKRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHTEEDVEKTL
PF00202         enaqekgerlkkgLe-------------------------------------------------------
PF00155         eLael....glkvlasq.sgmflltdlsae.........takelskk....Lleevgvyvtpgtsftvpg


                         -         -         +         -         -         -         -:490
query           EALGEAL---------------------------------------------------------------
PF00202         ----------------------------------------------------------------------
PF00155         rlR-------------------------------------------------------------------