[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS80932.1


[Show Plain Result]

## Summary of Sequence Search
   1::283
  78::280  PF02645 0.0% 34.9753694581281  Uncharacterised protein, DegV family COG1307 
   1::283


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASTPTASSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQV
PF02645         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           APEDLRKLYEALLRTHGRVVSVHVSGLLSGTVDTAKKVAQAFGERVKVLDSWSLSGGLLLVLERARRLLE
PF02645         -------lfeelvegydevivltiSsklSgtyqsakqaaeeeedkkvrviDSksvsaglgllvleaarla


                         +         -         -         -         -         *         -:210
query           EGVAWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
PF02645         kqGksfeeilkkleelrektklyfvvddLdyLvkgGRiskaaallgslLkikpilsledgelkpvakvrg


                         -         -         -         +         -         -         -:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPEGAKALGEALKAGGVEVLGALPAGAAVSVHTGPGTVAAFAG
PF02645         fkkaaikklleelleklaegkglevavahaaeeeeaeelkeelkakeeeedisiselgpvigvhtGpgal


                         -         *         -         -         -         -         +:350
query           PRG-------------------------------------------------------------------
PF02645         ----------------------------------------------------------------------