[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81022.1


[Show Plain Result]

## Summary of Sequence Search
   1::434
  99::293  PF00448 0.0% 58.4615384615385  SRP54-type protein, GTPase domain 
 320::417  PF02978 0.0% 54.0816326530612  Signal peptide binding domain 
   6::82   PF02881 0.0% 31.0810810810811  SRP54-type protein, helical bundle domain 
 108::271  PF01656 0.0% 28.2894736842105  CobQ/CobB/MinD/ParA nucleotide binding domain 
 101::248  PF02492 0.0% 26.6187050359712  CobW/HypB/UreG, nucleotide-binding domain 
  92::138  PF06414 0.0% 26.6666666666667  Zeta toxin 
 143::176  PF06414 0.0% 32.3529411764706  Zeta toxin 
   1::434


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLEVARAFVEEVRERALGRKVLESLTP
PF00448         ----------------------------------------------------------------------
PF02978         ----------------------------------------------------------------------
PF02881         -----kkglsktrnkltgklfltekkidelleeleeaLleaDVgvevvkkliervreklvg...kkgvsp
PF01656         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
PF00448         ----------------------------nvillvGlqGaGKTTtlaKLAallkkegkkvllvaaDtfRaa
PF02978         ----------------------------------------------------------------------
PF02881         keeikkilkdeL----------------------------------------------------------
PF01656         -------------------------------------GvGKTtlaanLaralakrglrVlliDlDpqann
PF02492         ------------------------------tvltGflGsGKTtLleklle.knraglkiavivndfge.t
PF06414         ---------------------vpeqekpkavllgGqpGAGKtslaellleela..agnivridaDelr--
PF06414         ---------------------vpeqekpkavllgGqpGAGKtslaellleela..agnivridaDelr--


                         +         -         -         -         -         *         -:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIRRRVEERARLEVRDLVLVDTAGRLQIDERLMEELVRLKAALR
PF00448         AveQLktlaeklgvpvikekeekdpaavakeavekakeekidvvlvDTaGrlqndkelmeelkkikkvlk
PF02978         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF01656         ssllgkveilkkglekasal.lenfeagllaegeeglvesllkkalealikea.yDvviiDgapglgel.
PF02492         siDaell..retgveivelnnGciCctlredllmelealeelkerldvlliEttG.laepaplld....l
PF06414         --rklkkagykvevvivavpkelSelgilqRyeeel----------------------------------
PF06414         --rklkkagykvevvivavpkelSelgilqRyeeel----------------------------------


                         -         -         -         +         -         -         -:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
PF00448         pdevllvldatigqealkqakaFkeaveltgviltklDgdakgGaalsiaaelklPikfigvGekiedle
PF02978         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF01656         .......vanalqaadllvvviepek..fsvegakrilellerlgkklkilgvvlnkvdrg---------
PF02492         ksdlgldavvavvdvknltegedkpekledqlaaAdli--------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PFYPDRLAGRILGMGDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGR
PF00448         efdperlvsrllg---------------------------------------------------------
PF02978         ---------------------------------------ftledfleqlkqikkmGslkkllkmlPglgs
PF02881         ----------------------------------------------------------------------
PF01656         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
PF00448         ----------------------------------------------------------------------
PF02978         lakdlpeekeeqaaekelkkleaiidSMTkkErqnpelledsRvrRiakGsGtsveevneLlkqfkq---
PF02881         ----------------------------------------------------------------------
PF01656         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ERRKGRGLMGMFRR--------------------------------------------------------
PF00448         ----------------------------------------------------------------------
PF02978         ----------------------------------------------------------------------
PF02881         ----------------------------------------------------------------------
PF01656         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------