[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81035.1


[Show Plain Result]

## Summary of Sequence Search
   1::433
 240::273  PF01957 0.0% 52.9411764705882  NfeD-like 
 288::430  PF01957 0.0% 29.2307692307692  NfeD-like 
  37::121  PF00574 0.0% 22.3529411764706  Clp protease 
  64::127  PF01972 0.0% 32.8125  Serine dehydrogenase proteinase 
   1::433


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGHTFSLRAYRIRAVKRLWALILLLPIALGKTYLVPIEGEIDPALAVFVEQALARAEREGASGVAFLIDT
PF01957         ----------------------------------------------------------------------
PF01957         ----------------------------------------------------------------------
PF00574         ------------------------------------lgeevddevankiiaqLlfLesedsdkdislyin
PF01972         ---------------------------------------------------------------idliiht


                         -         -         *         -         -         -         -:140
query           PGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSEIGAALPVVALPLQEPQAADQ
PF01957         ----------------------------------------------------------------------
PF01957         ----------------------------------------------------------------------
PF00574         SpGGsvtaglaIydtlkfikpdvsticlGlaaSmaslilaaGekgkRialp-------------------
PF01972         pGGlvlaatqiakalkehkaktrvivphyamsGGtlialaadeiildenavlGpvdp-------------


                         +         -         -         -         -         *         -:210
query           KVISALKGKFRAVAEARGRPVELAEAMVDPNLEVPGLSAKGEPLTLSADKAVELKVADLKAASLYEALQA
PF01957         ----------------------------------------------------------------------
PF01957         ----------------------------------------------------------------------
PF00574         ----------------------------------------------------------------------
PF01972         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AGFSPEVERLAPGPRVQVARFLTSSTVAGLLLALGLLLLLVELFTPGFGVAGALGLAFLALYFAGGWLAG
PF01957         -----------------------------lliilGlvLlvaEaltptfgvlglgGlaalviga-------
PF01957         -----------------------------lliilGlvLlvaEaltptfgvlglgGlaalviga-------
PF00574         ----------------------------------------------------------------------
PF01972         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LSGAFELLLFLLGVALLLAEAFLFPGFGIAGVLGVGSILASVYFTFGENALLVLSVAVIALGLGLVLVFR
PF01957         -------lliilGlvLlvaEal.tptfgvlglgGlaalvigallllsteavgleisplvilvlaiviaal
PF01957         -------lliilGlvLlvaEal.tptfgvlglgGlaalvigallllsteavgleisplvilvlaiviaal
PF00574         ----------------------------------------------------------------------
PF01972         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YLPRTRPAQALVLESAIQGHATEEAVEVGAVGTALTDLRPGGVARFGAKRVDVVANRGFIPKGTPVRVVE
PF01957         llfvaaavyralltrkkrksstgl...........eeliGkegtveeeiangeGrvkvdgerWrvrsede
PF01957         llfvaaavyralltrkkrksstgl...........eeliGkegtveeeiangeGrvkvdgerWrvrsede
PF00574         ----------------------------------------------------------------------
PF01972         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VRGITVVVEPLEE---------------------------------------------------------
PF01957         .iekGekVrV------------------------------------------------------------
PF01957         .iekGekVrV------------------------------------------------------------
PF00574         ----------------------------------------------------------------------
PF01972         ----------------------------------------------------------------------