[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81141.1


[Show Plain Result]

## Summary of Sequence Search
   1::244
  44::167  PF00005 0.0% 41.2280701754386  ABC transporter 
  33::207  PF02463 0.0% 22.6744186046512  RecF/RecN/SMC N terminal domain 
  33::52   PF09818 0.0% 35  Predicted ATPase of the ABC class 
 139::214  PF09818 0.0% 34.2105263157895  Predicted ATPase of the ABC class 
  31::61   PF03193 0.0% 41.9354838709677  Protein of unknown function, DUF258 
   1::244


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKD
PF00005         -------------------------------------------STLlklltgelkptegeievdn.drkd
PF02463         --------------------------------taivGpNGSGKsnvldAilFvLGeksakklrseklsdl
PF09818         --------------------------------tlIvGggyhGKsTLLeAlea------------------
PF09818         --------------------------------tlIvGggyhGKsTLLeAlea------------------
PF03193         ------------------------------ktsvlvGqSGvGKSsLinallpeldlkvgev---------


                         -         -         *         -         -         -         -:140
query           DRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPREKAEKKALELLERVGILDQARKYPAQLS
PF00005         les.dkleklr..igyipqdpllfpeltvrenldmakeekk......tdkrieevlekvgldelldksrv
PF02463         ihkskskakvksaeveitfdnedkelvieeee.vsitrrvkrkgeseykingkevtkkevaellesagis
PF09818         --------------------------------------------------------------------AS
PF09818         --------------------------------------------------------------------AS
PF03193         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVF
PF00005         stLSgGqkqrvalArallkkpklllLD-------------------------------------------
PF02463         kelLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkekskn.aQfivislre---
PF09818         GStsqAanimealeagakllLiDEDtsAtNllirDermqelvakekepitplvdrvrelyeklgvstilv
PF09818         GStsqAanimealeagakllLiDEDtsAtNllirDermqelvakekepitplvdrvrelyeklgvstilv
PF03193         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MDGGQIVEEGRPEEIFTRPKEERTRSFLQRVLHH------------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF09818         vggs------------------------------------------------------------------
PF09818         vggs------------------------------------------------------------------
PF03193         ----------------------------------------------------------------------