[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81265.1


[Show Plain Result]

## Summary of Sequence Search
   1::342
 214::304  PF09002 0.0% 33.3333333333333  Domain of unknown function (DUF1887) 
   1::342


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGVLTRYLEETMAKARYDLVSPGRYVGELAEFGLRVEGENLEATRRALREALELHLLETLRSGLLPPGLE
PF09002         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ATPDPLRERFFALAQEMWRLLREAPAPLPRPRKAPSLEEWLKGLGVQVVRRPEEGEEERERVLNRLALFL
PF09002         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GDRYPSLERLYERLKQSLSTKRQFELSLAEASPEEIANSTQFCTLLKQYALLTSYRYKSEDRLLRAKAST
PF09002         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EGWVQNFLTGGWLERYVAERLRKYLRSKNLPHEVAVGYQVTLPGGEAMELDVLVRVGERFYWFEAKTGEF
PF09002         ---arrflnGeWLEvfvyktvrdiqd....vqDvslgvqvvrkkgekevrNeLDVvfivnnklhiiECKt


                         -         *         -         -         -         -         +:350
query           QAHIAKYAGLKKVLGLSQKESFLVLLGMDRARAKELSALHGLTVVNQANFLEAFQEALGAHA--------
PF09002         kgmeddeedddtLyKleslrdllg----------------------------------------------