[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81275.1


[Show Plain Result]

## Summary of Sequence Search
   1::618
   5::360  PF09334 0.0% 49.1428571428571  tRNA synthetases class I (M) 
 524::615  PF01588 0.0% 60.8695652173913  Putative tRNA binding domain 
   4::136  PF00133 0.0% 19.5488721804511  tRNA synthetases class I (I, L, M and V) 
 143::217  PF00133 0.0% 20.2898550724638  tRNA synthetases class I (I, L, M and V) 
 223::336  PF00133 0.0% 40  tRNA synthetases class I (I, L, M and V) 
  14::122  PF01406 0.0% 23.1481481481481  tRNA synthetases class I (C) catalytic domain 
 293::340  PF01406 0.0% 34.0425531914894  tRNA synthetases class I (C) catalytic domain 
 390::476  PF08264 0.0% 25.5813953488372  Anticodon-binding domain 
   1::618


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
PF09334         ----ilvttalpYvngkpHlGhlystiaaDvlarykrlrgeevlfvtgtDehGtkielkAekegltpqel
PF01588         ----------------------------------------------------------------------
PF00133         ---kFvlvdgPPnatGslHiGhalaktlkdivirykrmkGkdveyvpGwDhhGlpieakvekklgkkekk
PF00133         ---kFvlvdgPPnatGslHiGhalaktlkdivirykrmkGkdveyvpGwDhhGlpieakvekklgkkekk
PF00133         ---kFvlvdgPPnatGslHiGhalaktlkdivirykrmkGkdveyvpGwDhhGlpieakvekklgkkekk
PF01406         -------------vydashlGhaRslvvfDvlrrilqalgYdvqfvqnvtDidDkiikrarqeeksvkel
PF01406         -------------vydashlGhaRslvvfDvlrrilqalgYdvqfvqnvtDidDkiikrarqeeksvkel
PF08264         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELV
PF09334         vdkvseefkelfkklnisfDkfirTtseehkelvqeffkklkekgliyekeieqlYcvsderflpdry.v
PF01588         ----------------------------------------------------------------------
PF00133         ereklgrekfrekvrewkaeyaeeirkqvkrLGvsvdwdreylTldeeleeavievfvelakkGli----
PF00133         ereklgrekfrekvrewkaeyaeeirkqvkrLGvsvdwdreylTldeeleeavievfvelakkGli----
PF00133         ereklgrekfrekvrewkaeyaeeirkqvkrLGvsvdwdreylTldeeleeavievfvelakkGli----
PF01406         aekfieeykkdleaLnvlkptletrvtekideiielv.ekliekgyaYvssd------------------
PF01406         aekfieeykkdleaLnvlkptletrvtekideiielv.ekliekgyaYvssd------------------
PF08264         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
PF09334         egtcPkcksekargdqceecgkklepkelinpksaisgskpevkeeehyffklskfeeklkewikenkel
PF01588         ----------------------------------------------------------------------
PF00133         --fcwrsktpiiyrateqWfvkvkelaeaalkave..kvkfvpkskekrykswlen.iqdWcisRqrw..
PF00133         --fcwrsktpiiyrateqWfvkvkelaeaalkave..kvkfvpkskekrykswlen.iqdWcisRqrw..
PF00133         --fcwrsktpiiyrateqWfvkvkelaeaalkave..kvkfvpkskekrykswlen.iqdWcisRqrw..
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
PF09334         .pkenvkevlkewlkegLkdlsis...rdlkwGipvpedekkviYVWlDAligYisalkelskkageeek
PF01588         ----------------------------------------------------------------------
PF00133         .WGtrip-----vlDvWFdSgstpfsvlgypeentkefkkffpadllleGlDqir....gWvarlillsl
PF00133         .WGtrip-----vlDvWFdSgstpfsvlgypeentkefkkffpadllleGlDqir....gWvarlillsl
PF00133         .WGtrip-----vlDvWFdSgstpfsvlgypeentkefkkffpadllleGlDqir....gWvarlillsl
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
PF09334         fkkfwakdkevelvhfiGkDiirfHaifwPamllaaglklpkkvvahgyltv.egekmSkSrgnvvdpee
PF01588         ----------------------------------------------------------------------
PF00133         altgkepykevlvhglvldeeGrKMSKslgNvidpldvikkygadalRltliassd--------------
PF00133         altgkepykevlvhglvldeeGrKMSKslgNvidpldvikkygadalRltliassd--------------
PF00133         altgkepykevlvhglvldeeGrKMSKslgNvidpldvikkygadalRltliassd--------------
PF01406         ------------iegekmsksLknfltikdvlkkfdprqlRllllsa.hyrsqldfkeel----------
PF01406         ------------iegekmsksLknfltikdvlkkfdprqlRllllsa.hyrsqldfkeel----------
PF08264         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAKRLRPLVRELKFHVALEEAMAYVKALNRYINE
PF09334         lleelgvdal------------------------------------------------------------
PF01588         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ---------------------------------------evteayeeyrfnkavsalyeffwndlcdwyl


                         -         -         +         -         -         -         -:490
query           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
PF09334         ----------------------------------------------------------------------
PF01588         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         elvkprlysesaeds.rraqyvllevletllrllaPimPfltEelwqrleeeklgk--------------


                         *         -         -         -         -         +         -:560
query           EEAPVLFPKKEAKVEAKPKEEAWIGIEDFAKVELRVAEVLAAEKHPNADRLLVLRLSLGNEERTVVSGIA
PF09334         ----------------------------------------------------------------------
PF01588         ---------------------------------lrvGkvleaekhpnadkLlvlkvdvGeeerqivsgak
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGEALALVTVEGEVPPGAVVK------------
PF09334         ----------------------------------------------------------------------
PF01588         nvyapeelvaklvvvvanlkpkklrGveSeGMilsaeeleeeevellelpeevea---------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF00133         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------