[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81311.1


[Show Plain Result]

## Summary of Sequence Search
   1::259
  43::179  PF00005 0.0% 38.7931034482759  ABC transporter 
 230::251  PF12399 0.0% 81.8181818181818  Branched-chain amino acid ATP-binding cassette tran 
   1::259


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS
PF00005         ------------------------------------------STLlklltgelkptegeievd.ndrkdl
PF12399         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPLARKEERKALEEALSLLEYVG
PF00005         esdkleklrigyipqdpllfpeltvrenldmakeekk....................tdkrieevlekvg
PF12399         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LLHRKDELARNLPYGEQRKLEIARALALKPKLLLLDEPAAGMNPKETEALQEFILKIRSEMGLTILLIEH
PF00005         ldelldksrvstLSgGqkqrvalArallkkpklllLDEP-------------------------------
PF12399         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYLGRGAAGGAA---------------------
PF00005         ----------------------------------------------------------------------
PF12399         -------------------vIAeGtPeEvrndPrVieAYLG-----------------------------