[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81342.1


[Show Plain Result]

## Summary of Sequence Search
   1::236
  26::83   PF02754 0.0% 32.7586206896552  Cysteine-rich domain 
 153::210  PF02754 0.0% 29.3103448275862  Cysteine-rich domain 
   1::236


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVALFITCLADQFYAEAGVAAVRLLRALGVEVDFPQGQTCCGQPAFNAGYWDEARPLAKRTLEVFEEAE
PF02754         -------------------------leilgvefvempedekCCGagggrsgnkeedlfqelgkenvesle
PF02754         -------------------------leilgvefvempedekCCGagggrsgnkeedlfqelgkenvesle


                         -         -         *         -         -         -         -:140
query           YVVLPSGSCASMVKNHYPELLPGNREALAMAEKTYELSQFLVRVLGVEKLGEGLKGRRVAYHHGCHALRE
PF02754         etgadkivttCpg---------------------------------------------------------
PF02754         etgadkivttCpg---------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LGVREEPLLLLQNAGAEILPWEAWEECCGFGGLFSVKLPEVSLAMADRKLATLPKAEVLTSTDAGCLLHL
PF02754         ------------ilgvefvempedekCCGagggrsgnkeedlfqelgkenvesleetgadkivttCpgCl
PF02754         ------------ilgvefvempedekCCGagggrsgnkeedlfqelgkenvesleetgadkivttCpgCl


                         -         -         -         +         -         -         -:280
query           AGRLGKKGENLRVAPLATLLWEAYAG--------------------------------------------
PF02754         ----------------------------------------------------------------------
PF02754         ----------------------------------------------------------------------