[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81487.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   2::191  PF00702 0.0% 27.3255813953488  haloacid dehalogenase-like hydrolase 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLETALGLWREFHR
PF00702         -ikavvfDkdGTLtdg.................eqpiaeaiveaakeaglsllakaeeveiatgrgvdei


                         -         -         *         -         -         -         -:140
query           RLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLAVVSNWDATLPEILEVVGLGR
PF00702         eeillegkltdelilanegearavsagktavivaidgelvglialadqvrpdarealraLkkaGikvvll


                         +         -         -         -         -         *         -:210
query           YFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGDAEADLLGAEAVGMRALLFDPLGENPKALPR
PF00702         Tgdnrataeavlkitglaaefdfivdsedvl.gkpkpealekaleklglkp-------------------


                         -         -         -         +         -         -         -:280
query           LERVLDYLP-------------------------------------------------------------
PF00702         ----------------------------------------------------------------------