[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81497.1


[Show Plain Result]

## Summary of Sequence Search
   1::725
 204::341  PF02769 0.0% 30.5970149253731  AIR synthase related protein, C-terminal domain 
 559::694  PF02769 0.0% 40.2985074626866  AIR synthase related protein, C-terminal domain 
  66::160  PF00586 0.0% 48.8888888888889  AIR synthase related protein, N-terminal domain 
 429::524  PF00586 0.0% 36.5591397849462  AIR synthase related protein, N-terminal domain 
 597::615  PF00586 0.0% 31.5789473684211  AIR synthase related protein, N-terminal domain 
   1::725


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         -----------------------------------------------------------------gddaa
PF00586         -----------------------------------------------------------------gddaa
PF00586         -----------------------------------------------------------------gddaa


                         -         -         *         -         -         -         -:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         vielgkdeelvvttdkvethnhptaidpydgaatavagnlrDiaamGAkplalldglalsnlldpee...
PF00586         vielgkdeelvvttdkvethnhptaidpydgaatavagnlrDiaamGAkplalldglalsnlldpee...
PF00586         vielgkdeelvvttdkvethnhptaidpydgaatavagnlrDiaamGAkplalldglalsnlldpee...


                         +         -         -         -         -         *         -:210
query           VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
PF02769         ---------------------------------------------------------------tgslglg
PF02769         ---------------------------------------------------------------tgslglg
PF00586         ..leeiveGladacnefgvp--------------------------------------------------
PF00586         ..leeiveGladacnefgvp--------------------------------------------------
PF00586         ..leeiveGladacnefgvp--------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GAAFASRELKEEKAEDRPAVQVGDPFLGKLLMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGV
PF02769         gsgtslkrkllessglp....qlgdallektliyvvqalaaeglvkaahDitgGGLlgalaemafasgvg
PF02769         gsgtslkrkllessglp....qlgdallektliyvvqalaaeglvkaahDitgGGLlgalaemafasgvg
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ELHLDLVPTREEGMTPEELLLSESQERMVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGE
PF02769         aeidldevplfeelelelemlfsensGrllvvvppedaeavlalleeeglheaaviGevtd---------
PF02769         aeidldevplfeelelelemlfsensGrllvvvppedaeavlalleeeglheaaviGevtd---------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VVAEVPTEALAEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKPLAYTDGLNLG
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         --------ddaavielgkdeelvvttdkvethnhptaidpydgaatavagnlrDiaamGAkplalldgla
PF00586         --------ddaavielgkdeelvvttdkvethnhptaidpydgaatavagnlrDiaamGAkplalldgla
PF00586         --------ddaavielgkdeelvvttdkvethnhptaidpydgaatavagnlrDiaamGAkplalldgla


                         *         -         -         -         -         +         -:560
query           SPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAMVGVVGVLEVDKRAEMGFRRP
PF02769         --------------------------------------------------------------------kp
PF02769         --------------------------------------------------------------------kp
PF00586         lsnlldpee...leeiveGladacnefgvplvgG------------------------------------
PF00586         lsnlldpee...leeiveGladacnefgvplvgG------------------------------------
PF00586         lsnlldpee...leeiveGladacnefgvplvgG------------------------------------


                         -         -         -         *         -         -         -:630
query           GEVLLLIGEERGELGASEVLYLLTGKEFGHPPRLDLGREKAVQEAIRDLIQRGLTRTAHDVAEGGLLLAL
PF02769         Gdvliltgs..lglggsgtslkrkllessglpqlgdallektliyvvqalaaeglvkaahDitgGGLlga
PF02769         Gdvliltgs..lglggsgtslkrkllessglpqlgdallektliyvvqalaaeglvkaahDitgGGLlga
PF00586         ------------------------------------gaatavagnlrDiaamGAk---------------
PF00586         ------------------------------------gaatavagnlrDiaamGAk---------------
PF00586         ------------------------------------gaatavagnlrDiaamGAk---------------


                         -         +         -         -         -         -         *:700
query           AEMTFPYGVGATVEVREEGLEALFGEAPSRVLFTVEKTRLQEATLLLEERGLPYRVLGETGGKSLTVLTP
PF02769         laemafasgvgaeidldevplfeelelelemlfsensGrllvvvppedaeavlalleeeglhea------
PF02769         laemafasgvgaeidldevplfeelelelemlfsensGrllvvvppedaeavlalleeeglhea------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           GGVLEWSLEELLSAWKAPLREVLDG---------------------------------------------
PF02769         ----------------------------------------------------------------------
PF02769         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------
PF00586         ----------------------------------------------------------------------