[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81529.1


[Show Plain Result]

## Summary of Sequence Search
   1::503
   3::182  PF00117 0.0% 37.7777777777778  Glutamine amidotransferase class-I 
 413::502  PF00958 0.0% 65.5555555555556  GMP synthase C terminal domain 
  70::166  PF07722 0.0% 35.0515463917526  Peptidase C26 
 196::272  PF02540 0.0% 31.1688311688312  NAD synthase 
 351::380  PF02540 0.0% 40  NAD synthase 
 212::252  PF01171 0.0% 53.6585365853659  PP-loop family 
 211::242  PF03054 0.0% 50  tRNA methyl transferase 
 197::238  PF00733 0.0% 35.7142857142857  Asparagine synthase 
   1::503


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVLVLDFGSQYTRLIARRLRELRAFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
PF00117         --lliDnydsvtknlaralrelgvkvevvpndadaeeileklknpdgilisgGpgspgavegkieaikea
PF00958         ----------------------------------------------------------------------
PF07722         ---------------------------------------------------------------------r
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
PF00117         renkiPiLGICLGmQllaiefggkvikekkeehmggnmrlghdgkaallyglpnevivrhrHsyevnpke
PF00958         ----------------------------------------------------------------------
PF07722         gvPvlgiCrGlqllnvalggtlyqdikeepglsdhreheqdasshavslekgsllarllgaeeievnslH
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTPEHVLEELLREVRERAGKD
PF00117         llpeglevtaksedggeimaivekknpivgvQFHPEssstpg----------------------------
PF00958         ----------------------------------------------------------------------
PF07722         hqaikelakglevlAtaedgvieaie--------------------------------------------
PF02540         -------------------------------------------------------lvdflkeyvkksgak
PF02540         -------------------------------------------------------lvdflkeyvkksgak
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         --------------------------------------------------------elLedavkrrlrad


                         -         -         -         +         -         -         -:280
query           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHGLLRLGEREEVEGALRALGVNLLVVDAKERFLKALKG
PF00117         ----------------------------------------------------------------------
PF00958         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         gvvlGlSGGvDSalvaalavkalgkenvlalimPssvsseedvedalalaeklgiesktidi--------
PF02540         gvvlGlSGGvDSalvaalavkalgkenvlalimPssvsseedvedalalaeklgiesktidi--------
PF01171         -vlvAvSGGlDSmaLlkllkklkkklgiklvavhvdhglree----------------------------
PF03054         kvvvalSgGVDSsvaalllkeqgyevigvfmk--------------------------------------
PF00733         vpvgvlLSGGlDSsliaalaaresskpl------------------------------------------


                         -         *         -         -         -         -         +:350
query           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGLPEDLEFEL
PF00117         ----------------------------------------------------------------------
PF00958         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LEPFRLLFKDEVRELALLLGLPDTLRLRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
PF00117         ----------------------------------------------------------------------
PF00958         --------------------------------------------------------------lkkaglyk
PF07722         ----------------------------------------------------------------------
PF02540         lapiaellKtevyeLakrlnvPervikkaP----------------------------------------
PF02540         lapiaellKtevyeLakrlnvPervikkaP----------------------------------------
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
PF00117         ----------------------------------------------------------------------
PF00958         kvwqafavllpvksvGvqgdkRtysyvvvlRavetsdfmtadvaelplevLeeiskrivnevegvsrVvy
PF07722         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DLTSKPPATIEWE---------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF00958         ditsKPPaTiEw----------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF01171         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------