[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81530.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
  43::147  PF05685 0.0% 36.5384615384615  Protein of unknown function (DUF820) 
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGEPARLRRLTAEEYLREEATSPVKRELVEGVPYAMAGAGRAHNLIVTNLVLLLGPLARRKGGRLYVADM
PF05685         ------------------------------------------heeiaglLaallelwveqrrlgvvfasd


                         -         -         *         -         -         -         -:140
query           KLKVGEATFYYPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREKLWRYLSLPSLEGYLLVSARE
PF05685         lgvylpeeeserePDvsvvlgeelrlsyeeweelgaaPdlvvEVlspsteeedlgeKlelYa.elgvpey


                         +         -         -         -         -         *         -:210
query           RRVELYRKEGDILHQVAEEGEVPLPCLEGSLPVAEVYAGVELEGQEA-----------------------
PF05685         wlvdpke---------------------------------------------------------------